KEGG   Homo sapiens (human): 5562Help
Entry
5562              CDS       T01001                                 

Gene name
PRKAA1, AMPK, AMPKa1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Buformin (DG00114): D00595 D02206
Dapiclermin: D03647
Metformin (DG00113): D00944 D04966
Phenformin (DG00112): D08351 D08352
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    5562 (PRKAA1)
   04068 FoxO signaling pathway
    5562 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    5562 (PRKAA1)
   04152 AMPK signaling pathway
    5562 (PRKAA1)
   04150 mTOR signaling pathway
    5562 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5562 (PRKAA1)
  Cellular community - eukaryotes
   04530 Tight junction
    5562 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5562 (PRKAA1)
   04922 Glucagon signaling pathway
    5562 (PRKAA1)
   04920 Adipocytokine signaling pathway
    5562 (PRKAA1)
   04921 Oxytocin signaling pathway
    5562 (PRKAA1)
  Aging
   04211 Longevity regulating pathway - mammal
    5562 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    5562 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    5562 (PRKAA1)
   04714 Thermogenesis
    5562 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5562 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    5562 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5562 (PRKAA1)
   04931 Insulin resistance
    5562 (PRKAA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5562 (PRKAA1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   5562 (PRKAA1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    5562 (PRKAA1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    5562 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    5562 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH
Motif
Other DBs
NCBI-GeneID: 5562
NCBI-ProteinID: NP_006242
OMIM: 602739
HGNC: 9376
Ensembl: ENSG00000132356
Vega: OTTHUMG00000162269
Pharos: Q13131(Tchem)
UniProt: Q13131
Structure
PDB: 

Jmol
Position
5p13.1
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacattctgggtgacacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagtagctgtgaagatactcaatcga
cagaagattcggagccttgatgtggtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaagaatgga
aggctggatgaaaaagaaagtcggcgtctgttccaacagatcctttctggtgtggattat
tgtcacaggcatatggtggtccatagagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattg
tatgcaggcccagaggtagatatatggagcagtggggttattctctatgctttattatgt
ggaacccttccatttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttctatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatcccatgaagagggccacaatcaaagatatcagggaacatgaatggtttaaa
caggaccttccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgat
gatgaagccttaaaagaagtatgtgaaaagtttgagtgctcagaagaggaagttctcagc
tgtctttacaacagaaatcaccaggatcctttggcagttgcctaccatctcataatagat
aacaggagaataatgaatgaagccaaagatttctatttggcgacaagcccacctgattct
tttcttgatgatcatcacctgactcggccccatcctgaaagagtaccattcttggttgct
gaaacaccaagggcacgccatacccttgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttaggaattagaagtcaaagtcgaccaaatgatatt
atggcagaagtatgtagagcaatcaaacaattggattatgaatggaaggttgtaaaccca
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacttactccaaaatgagtcta
cagttataccaagtggatagtagaacttatctactggatttccgtagtattgatgatgaa
attacagaagccaaatcagggactgctactccacagagatcgggatcagttagcaactat
cgatcttgccaaaggagtgattcagatgctgaggctcaaggaaaatcctcagaagtttct
cttacctcatctgtgacctcacttgactcttctcctgttgacctaactccaagacctgga
agtcacacaatagaattttttgagatgtgtgcaaatctaattaaaattcttgcacaataa

DBGET integrated database retrieval system