KEGG   Homo sapiens (human): 55627Help
Entry
55627             CDS       T01001                                 

Gene name
SMPD4, NET13, NSMASE-3, NSMASE3
Definition
sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (EC:3.1.4.12)
Orthology
K12353  
sphingomyelin phosphodiesterase 4 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:hsa00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.1
AA seq 764 aa AA seqDB search
MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAMAFPHLQQPSFLLASLKADSI
NKPFAQQCQDLVKVIEDFPAKGPVKASIQECILPDSPLYHNKVQFTPTGGLGLNLALNPF
EYYIFFFALSLITQKPLPVSLHVRTSDCAYFILVDRYLSWFLPTEGSVPPPLSSSPGGTS
PSPPPRTPAIPFASYGLHHTSLLKRHISHQTSVNADPASHEIWRSETLLQVFVEMWLHHY
SLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHATSPLEE
FKRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQP
RCVSEKWAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQ
KGEQLFLEPELVIPHRQHRLFTAPTFTGSFLSPWPPAVTDASFKVKSHVYSLEGQDCKYT
PMFGPEARTLVLRLAQLITQAKHTAKSISDQCAESPAGHSFLSWLGFSSMDTNGSYTAND
LDEMGQDSVRKTDEYLEKALEYLRQIFRLSEAQLRQFTLALGTTQDENGKKQLPDCIVGE
DGLILTPLGRYQIINGLRRFEIEYQGDPELQPIRSYEIASLVRTLFRLSSAINHRFAGQM
AALCSRDDFLGSFCRYHLTEPGLASRHLLSPVGRRQVAGHTRGPRLSLRFLGSYRTLVSL
LLAFFVASLFCVGPLPCTLLLTLGYVLYASAMTLLTERGKLHQP
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgacgactttcggcgccgtggcggaatggcggcttccatctctgaggcgagcgacgcta
tggatcccacagtggtttgctaagaaggccattttcaactctccactggaggctgctatg
gcgttccctcacctgcagcagcccagctttctactggctagcctgaaagctgactctata
aataagccctttgcacagcagtgccaagacttggttaaagtcattgaggactttccagca
aagggtcctgtgaaggcgtccatccaggagtgcatcctccctgacagtcctctgtaccac
aacaaggtccagttcacccctactgggggccttggtctgaacttggccctgaatccgttc
gagtattacatattcttctttgccttgagcctcatcactcagaagccacttcctgtgtcc
ctccacgtccgtacttcagactgtgcctatttcatcctggtggacaggtacctgtcatgg
ttcctgcccaccgaaggcagtgtgcccccaccactctcctccagcccaggggggaccagc
ccctcaccacctcccaggacaccagccataccctttgcttcctatggcctccaccacact
agcctcctaaagcgacacatctctcatcagacgtctgtgaatgcagaccccgcctcccac
gagatctggaggtcagaaactctgctccaggtttttgttgaaatgtggcttcatcactat
tccttggagatgtatcaaaaaatgcagtcccctcatgccaaggagtcgttcacgcctact
gaggagcatgtgttggtggtgcgcctgctgctgaagcacctgcacgcctttgccaacagc
ctgaagccagagcaggcctcaccctccgcccactcccacgccaccagccccctggaggag
ttcaaacgggctgctgtcccgaggttcgtccagcagaaactctacctcttcttgcagcat
tgctttggccactggcccctggacgcatcgttcagagctgtcctggagatgtggctgagc
tacctgcagccgtggcggtacgcgcctgacaagcaggctccgggcagcgactcccagccc
cggtgtgtgtcggagaaatgggcaccctttgtccaggagaacctgctgatgtacaccaag
ttgtttgtgggctttctgaaccgcgcgctccgcacagacctggtcagccccaagcacgcg
ctcatggtgttccgagtggccaaagtctttgcccagcccaacctggctgagatgattcag
aaaggtgagcagctattcctggagccagagctggtcatcccccaccgccagcaccgactc
ttcacggcccccacattcactgggagcttcctgtcaccctggccaccagcggtcactgat
gcctccttcaaggtgaagagccacgtctacagcctggagggccaggactgcaagtacacc
ccgatgtttgggcccgaggcccgcaccctggtcctgcgcctcgctcagctcatcacacag
gccaaacacacagccaagtccatctccgaccagtgtgcggagagcccggctggccactcc
ttcctctcatggctgggctttagctccatggacaccaatggctcctacacagccaacgac
ctggacgagatggggcaagacagtgtccggaagacagatgaatacctggagaaggccctg
gagtacctgcgccagatattccggctcagcgaagcgcagctcaggcagttcacactcgcc
ttgggcaccacccaggatgagaatggaaaaaagcaactccccgactgcatcgtgggtgag
gacggactcatccttacgcccctggggcggtaccagatcatcaatgggctgcgaaggttt
gaaattgagtaccagggggacccggagctgcagcccatccggagctatgagatcgccagc
ttggtccgcacactctttaggctgtcgtctgccatcaaccacagatttgcaggacagatg
gcggctctgtgttcccgggatgacttcctcggcagcttctgtcgctaccacctcacagaa
cctgggctggccagcaggcacctgctgagccctgtggggcggaggcaggtggccggccac
acccgcggccccaggctcagcctgcgcttcctgggcagttaccggacgctggtctcgctg
ctgctggccttcttcgtggcctctctgttctgcgtcgggcccctcccatgcacgctgctg
ctcaccctgggctatgtcctctacgcctctgccatgacactgctgaccgagcgggggaag
ctgcaccagccctga

DBGET integrated database retrieval system