KEGG   Homo sapiens (human): 55627Help
Entry
55627             CDS       T01001                                 

Gene name
SMPD4, NET13, NSMASE-3, NSMASE3
Definition
(RefSeq) sphingomyelin phosphodiesterase 4
  KO
K12353  
sphingomyelin phosphodiesterase 4 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Drug target
Olipudase alfa: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    55627 (SMPD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     55627 (SMPD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.1
AA seq 837 aa AA seqDB search
MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAMAFPHLQQPSFLLASLKADSI
NKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYS
IVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSYLPGPVKASIQECILPDSPLYHNKVQFTP
TGGLGLNLALNPFEYYIFFFALSLITQKPLPVSLHVRTSDCAYFILVDRYLSWFLPTEGS
VPPPLSSSPGGTSPSPPPRTPAIPFASYGLHHTSLLKRHISHQTSVNADPASHEIWRSET
LLQVFVEMWLHHYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPEQAS
PSAHSHATSPLEEFKRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRY
APDKQAPGSDSQPRCVSEKWAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVA
KVFAQPNLAEMIQKGEQLFLEPELVIPHRQHRLFTAPTFTGSFLSPWPPAVTDASFKVKS
HVYSLEGQDCKYTPMFGPEARTLVLRLAQLITQAKHTAKSISDQCAESPAGHSFLSWLGF
SSMDTNGSYTANDLDEMGQDSVRKTDEYLEKALEYLRQIFRLSEAQLRQFTLALGTTQDE
NGKKQLPDCIVGEDGLILTPLGRYQIINGLRRFEIEYQGDPELQPIRSYEIASLVRTLFR
LSSAINHRFAGQMAALCSRDDFLGSFCRYHLTEPGLASRHLLSPVGRRQVAGHTRGPRLS
LRFLGSYRTLVSLLLAFFVASLFCVGPLPCTLLLTLGYVLYASAMTLLTERGKLHQP
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgacgactttcggcgccgtggcggaatggcggcttccatctctgaggcgagcgacgcta
tggatcccacagtggtttgctaagaaggccattttcaactctccactggaggctgctatg
gcgttccctcacctgcagcagcccagctttctactggctagcctgaaagctgactctata
aataagccctttgcacagcagtgccaagacttggttaaagtcattgaggactttccagca
aaggagctgcacaccatcttcccatggctggtagaaagcatttttggcagcctagatggt
gtcctcgttggctggaacctccgctgcttacaggggcgcgtgaatcctgtggagtacagc
atcgtgatggaatttctcgaccctggtggcccaatgatgaagttggtttataagcttcaa
gctgaagactataagttcgactttcctgtctcctacttgcctggtcctgtgaaggcgtcc
atccaggagtgcatcctccctgacagtcctctgtaccacaacaaggtccagttcacccct
actgggggccttggtctgaacttggccctgaatccgttcgagtattacatattcttcttt
gccttgagcctcatcactcagaagccacttcctgtgtccctccacgtccgtacttcagac
tgtgcctatttcatcctggtggacaggtacctgtcatggttcctgcccaccgaaggcagt
gtgcccccaccactctcctccagcccaggggggaccagcccctcaccacctcccaggaca
ccagccataccctttgcttcctatggcctccaccacactagcctcctaaagcgacacatc
tctcatcagacgtctgtgaatgcagaccccgcctcccacgagatctggaggtcagaaact
ctgctccaggtttttgttgaaatgtggcttcatcactattccttggagatgtatcaaaaa
atgcagtcccctcatgccaaggagtcgttcacgcctactgaggagcatgtgttggtggtg
cgcctgctgctgaagcacctgcacgcctttgccaacagcctgaagccagagcaggcctca
ccctccgcccactcccacgccaccagccccctggaggagttcaaacgggctgctgtcccg
aggttcgtccagcagaaactctacctcttcttgcagcattgctttggccactggcccctg
gacgcatcgttcagagctgtcctggagatgtggctgagctacctgcagccgtggcggtac
gcgcctgacaagcaggctccgggcagcgactcccagccccggtgtgtgtcggagaaatgg
gcaccctttgtccaggagaacctgctgatgtacaccaagttgtttgtgggctttctgaac
cgcgcgctccgcacagacctggtcagccccaagcacgcgctcatggtgttccgagtggcc
aaagtctttgcccagcccaacctggctgagatgattcagaaaggtgagcagctattcctg
gagccagagctggtcatcccccaccgccagcaccgactcttcacggcccccacattcact
gggagcttcctgtcaccctggccaccagcggtcactgatgcctccttcaaggtgaagagc
cacgtctacagcctggagggccaggactgcaagtacaccccgatgtttgggcccgaggcc
cgcaccctggtcctgcgcctcgctcagctcatcacacaggccaaacacacagccaagtcc
atctccgaccagtgtgcggagagcccggctggccactccttcctctcatggctgggcttt
agctccatggacaccaatggctcctacacagccaacgacctggacgagatggggcaagac
agtgtccggaagacagatgaatacctggagaaggccctggagtacctgcgccagatattc
cggctcagcgaagcgcagctcaggcagttcacactcgccttgggcaccacccaggatgag
aatggaaaaaagcaactccccgactgcatcgtgggtgaggacggactcatccttacgccc
ctggggcggtaccagatcatcaatgggctgcgaaggtttgaaattgagtaccagggggac
ccggagctgcagcccatccggagctatgagatcgccagcttggtccgcacactctttagg
ctgtcgtctgccatcaaccacagatttgcaggacagatggcggctctgtgttcccgggat
gacttcctcggcagcttctgtcgctaccacctcacagaacctgggctggccagcaggcac
ctgctgagccctgtggggcggaggcaggtggccggccacacccgcggccccaggctcagc
ctgcgcttcctgggcagttaccggacgctggtctcgctgctgctggccttcttcgtggcc
tctctgttctgcgtcgggcccctcccatgcacgctgctgctcaccctgggctatgtcctc
tacgcctctgccatgacactgctgaccgagcgggggaagctgcaccagccctga

DBGET integrated database retrieval system