KEGG   Homo sapiens (human): 5564Help
Entry
5564              CDS       T01001                                 

Gene name
PRKAB1, AMPK, HAMPKb
Definition
protein kinase, AMP-activated, beta 1 non-catalytic subunit
Orthology
K07199  
5'-AMP-activated protein kinase, regulatory beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5564 (PRKAB1)
   04152 AMPK signaling pathway
    5564 (PRKAB1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5564 (PRKAB1)
   04920 Adipocytokine signaling pathway
    5564 (PRKAB1)
   04921 Oxytocin signaling pathway
    5564 (PRKAB1)
  Environmental adaptation
   04710 Circadian rhythm
    5564 (PRKAB1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    5564 (PRKAB1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5564 (PRKAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.1-q24.3
AA seq 270 aa AA seqDB search
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataccagcagtgagcgcgccgcgctggagcggcatggtggccataagacgccc
cggagggacagctcggggggcaccaaggacggggacaggcccaagatcctgatggacagc
cccgaagacgccgacctcttccactccgaggaaatcaaggcaccagagaaggaggaattc
ctggcctggcagcatgatctggaagtgaatgataaagctcccgcccaggctcggccaacg
gtgtttcgatggacggggggcggaaaggaagtttacttatctgggtccttcaacaactgg
agtaaacttcccctcaccagaagccacaataactttgtagccatcctggatctgccggaa
ggagagcatcagtacaagttctttgtggatggtcagtggacgcacgacccttccgagccc
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agttctcccccaggaccctaccatcaggagccctacgtctgcaaacccgaagagcgcttt
cgggcaccccctattctccccccacatctcctccaggtcatcctgaacaaggacacgggg
atttcctgtgatccagctttgcttcctgagcccaatcacgtcatgctgaaccacctatac
gcgctgtctatcaaggatggagtgatggtgctcagcgcaacccaccggtacaagaagaag
tacgtcaccaccttgttatacaagcccatatga

DBGET integrated database retrieval system