KEGG   Homo sapiens (human): 5565Help
Entry
5565              CDS       T01001                                 

Gene name
PRKAB2
Definition
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Orthology
K07199  
5'-AMP-activated protein kinase, regulatory beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21.1
AA seq 272 aa AA seqDB search
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaccaccagcgaccgggtgtccggggagcgccacggcgccaaggctgcacgc
tccgagggcgcaggcggccatgccccggggaaggagcacaagatcatggtggggagtacg
gacgaccccagcgtgttcagcctccctgactccaagctccctggggacaaagagtttgta
tcatggcagcaggatttggaggactccgtaaagcccacacagcaggcccggcccactgtt
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagc
accaagattccactgattaagagccataatgactttgttgccatcctggacctccctgag
ggagagcaccaatacaagttctttgtggatggacagtgggttcatgatccatcagagcct
gtggttaccagtcagcttggcacaattaacaatttgatccatgtcaagaaatctgatttt
gaggtgttcgatgctttaaagttagattctatggaaagttctgagacatcttgtagagac
ctttccagctcacccccagggccttatggtcaagaaatgtatgcgtttcgatctgaggaa
agattcaaatccccacccatccttcctcctcatctacttcaagttattcttaacaaagac
actaatatttcttgtgacccagccttactccctgagcccaaccatgttatgctgaaccat
ctctatgcattgtccattaaggacagtgtgatggtccttagcgcaacccatcgctacaag
aagaagtatgttactactctgctatacaagcccatttga

DBGET integrated database retrieval system