KEGG   Homo sapiens (human): 5568Help
Entry
5568              CDS       T01001                                 

Gene name
PRKACG, KAPG, PKACg
Definition
protein kinase, cAMP-dependent, catalytic, gamma (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Vibrio cholerae infection
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5568 (PRKACG)
   04010 MAPK signaling pathway
    5568 (PRKACG)
   04310 Wnt signaling pathway
    5568 (PRKACG)
   04340 Hedgehog signaling pathway
    5568 (PRKACG)
   04020 Calcium signaling pathway
    5568 (PRKACG)
   04024 cAMP signaling pathway
    5568 (PRKACG)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5568 (PRKACG)
   04210 Apoptosis
    5568 (PRKACG)
  Cellular commiunity
   04540 Gap junction
    5568 (PRKACG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5568 (PRKACG)
   04062 Chemokine signaling pathway
    5568 (PRKACG)
  Endocrine system
   04911 Insulin secretion
    5568 (PRKACG)
   04910 Insulin signaling pathway
    5568 (PRKACG)
   04912 GnRH signaling pathway
    5568 (PRKACG)
   04913 Ovarian Steroidogenesis
    5568 (PRKACG)
   04915 Estrogen signaling pathway
    5568 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    5568 (PRKACG)
   04921 Oxytocin signaling pathway
    5568 (PRKACG)
   04918 Thyroid hormone synthesis
    5568 (PRKACG)
   04919 Thyroid hormone signaling pathway
    5568 (PRKACG)
   04916 Melanogenesis
    5568 (PRKACG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5568 (PRKACG)
   04270 Vascular smooth muscle contraction
    5568 (PRKACG)
  Digestive system
   04970 Salivary secretion
    5568 (PRKACG)
   04971 Gastric acid secretion
    5568 (PRKACG)
   04976 Bile secretion
    5568 (PRKACG)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5568 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5568 (PRKACG)
  Nervous system
   04724 Glutamatergic synapse
    5568 (PRKACG)
   04727 GABAergic synapse
    5568 (PRKACG)
   04725 Cholinergic synapse
    5568 (PRKACG)
   04728 Dopaminergic synapse
    5568 (PRKACG)
   04726 Serotonergic synapse
    5568 (PRKACG)
   04720 Long-term potentiation
    5568 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    5568 (PRKACG)
  Sensory system
   04740 Olfactory transduction
    5568 (PRKACG)
   04742 Taste transduction
    5568 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    5568 (PRKACG)
  Environmental adaptation
   04713 Circadian entrainment
    5568 (PRKACG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5568 (PRKACG)
   05205 Proteoglycans in cancer
    5568 (PRKACG)
   05203 Viral carcinogenesis
    5568 (PRKACG)
  Neurodegenerative diseases
   05012 Parkinson's disease
    5568 (PRKACG)
   05020 Prion diseases
    5568 (PRKACG)
  Substance dependence
   05030 Cocaine addiction
    5568 (PRKACG)
   05031 Amphetamine addiction
    5568 (PRKACG)
   05032 Morphine addiction
    5568 (PRKACG)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5568 (PRKACG)
  Infectious diseases
   05110 Vibrio cholerae infection
    5568 (PRKACG)
   05166 HTLV-I infection
    5568 (PRKACG)
   05169 Epstein-Barr virus infection
    5568 (PRKACG)
   05146 Amoebiasis
    5568 (PRKACG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5568 (PRKACG)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   5568 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q13
AA seq 351 aa AA seqDB search
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgtgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccaggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcacatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaagctccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccgtccagtacctacactcg
ctcgacctcatccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttcccacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaagcatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaagagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system