KEGG   Homo sapiens (human): 5573Help
Entry
5573              CDS       T01001                                 

Gene name
PRKAR1A, ACRDYS1, ADOHR, CAR, CNC, CNC1, PKR1, PPNAD1, PRKAR1, TSE1
Definition
protein kinase, cAMP-dependent, regulatory, type I, alpha (EC:2.7.11.1)
Orthology
K04739  
cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Insulin signaling pathway
Disease
H00260  
Pigmented micronodular adrenocortical disease (PPNAD)
H01102  
Pituitary adenomas
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    5573 (PRKAR1A)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5573 (PRKAR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24.2
AA seq 381 aa AA seqDB search
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggcagtaccgccgccagtgaggaggcacgcagccttcgagaatgtgagctc
tacgtccagaagcataacattcaagcgctgctcaaagattctattgtgcagttgtgcact
gctcgacctgagagacccatggcattcctcagggaatactttgagaggttggagaaggag
gaggcaaaacagattcagaatctgcagaaagcaggcactcgtacagactcaagggaggat
gagatttctcctcctccacccaacccagtggttaaaggtaggaggcgacgaggtgctatc
agcgctgaggtctacacggaggaagatgcggcatcctatgttagaaaggttataccaaaa
gattacaagacaatggccgctttagccaaagccattgaaaagaatgtgctgttttcacat
cttgatgataatgagagaagtgatatttttgatgccatgttttcggtctcctttatcgca
ggagagactgtgattcagcaaggtgatgaaggggataacttctatgtgattgatcaagga
gagacggatgtctatgttaacaatgaatgggcaaccagtgttggggaaggagggagcttt
ggagaacttgctttgatttatggaacaccgagagcagccactgtcaaagcaaagacaaat
gtgaaattgtggggcatcgaccgagacagctatagaagaatcctcatgggaagcacactg
agaaagcggaagatgtatgaggaattccttagtaaagtctctattttagagtctctggac
aagtgggaacgtcttacggtagctgatgcattggaaccagtgcagtttgaagatgggcag
aagattgtggtgcagggagaaccaggggatgagttcttcattattttagaggggtcagct
gctgtgctacaacgtcggtcagaaaatgaagagtttgttgaagtgggaagattggggcct
tctgattattttggtgaaattgcactactgatgaatcgtcctcgtgctgccacagttgtt
gctcgtggccccttgaagtgcgttaagctggaccgacctagatttgaacgtgttcttggc
ccatgctcagacatcctcaaacgaaacatccagcagtacaacagttttgtgtcactgtct
gtctga

DBGET integrated database retrieval system