KEGG   Homo sapiens (human): 5573Help
Entry
5573              CDS       T01001                                 

Gene name
PRKAR1A, ACRDYS1, ADOHR, CAR, CNC, CNC1, PKR1, PPNAD1, PRKAR1, TSE1
Definition
(RefSeq) protein kinase cAMP-dependent type I regulatory subunit alpha
  KO
K04739  
cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Disease
H00260  
Pigmented micronodular adrenocortical disease (PPNAD)
H01102  
Pituitary adenomas
H01431  
Cushing's syndrome
H01820  
Carney complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5573 (PRKAR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P10644(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q24.2
AA seq 381 aa AA seqDB search
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggcagtaccgccgccagtgaggaggcacgcagccttcgagaatgtgagctc
tacgtccagaagcataacattcaagcgctgctcaaagattctattgtgcagttgtgcact
gctcgacctgagagacccatggcattcctcagggaatactttgagaggttggagaaggag
gaggcaaaacagattcagaatctgcagaaagcaggcactcgtacagactcaagggaggat
gagatttctcctcctccacccaacccagtggttaaaggtaggaggcgacgaggtgctatc
agcgctgaggtctacacggaggaagatgcggcatcctatgttagaaaggttataccaaaa
gattacaagacaatggccgctttagccaaagccattgaaaagaatgtgctgttttcacat
cttgatgataatgagagaagtgatatttttgatgccatgttttcggtctcctttatcgca
ggagagactgtgattcagcaaggtgatgaaggggataacttctatgtgattgatcaagga
gagacggatgtctatgttaacaatgaatgggcaaccagtgttggggaaggagggagcttt
ggagaacttgctttgatttatggaacaccgagagcagccactgtcaaagcaaagacaaat
gtgaaattgtggggcatcgaccgagacagctatagaagaatcctcatgggaagcacactg
agaaagcggaagatgtatgaggaattccttagtaaagtctctattttagagtctctggac
aagtgggaacgtcttacggtagctgatgcattggaaccagtgcagtttgaagatgggcag
aagattgtggtgcagggagaaccaggggatgagttcttcattattttagaggggtcagct
gctgtgctacaacgtcggtcagaaaatgaagagtttgttgaagtgggaagattggggcct
tctgattattttggtgaaattgcactactgatgaatcgtcctcgtgctgccacagttgtt
gctcgtggccccttgaagtgcgttaagctggaccgacctagatttgaacgtgttcttggc
ccatgctcagacatcctcaaacgaaacatccagcagtacaacagttttgtgtcactgtct
gtctga

DBGET integrated database retrieval system