KEGG   Homo sapiens (human): 5573Help
Entry
5573              CDS       T01001                                 

Gene name
PRKAR1A, ACRDYS1, ADOHR, CAR, CNC, CNC1, PKR1, PPNAD1, PRKAR1, TSE1
Definition
(RefSeq) protein kinase cAMP-dependent type I regulatory subunit alpha
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Network
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Disease
H00260  Pigmented micronodular adrenocortical disease (PPNAD)
H01102  Pituitary adenomas
H01431  Cushing's syndrome
H01820  Carney complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5573 (PRKAR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding RIIa
Motif
Other DBs
NCBI-GeneID: 5573
NCBI-ProteinID: NP_001263218
OMIM: 188830
HGNC: 9388
Ensembl: ENSG00000108946
Vega: OTTHUMG00000180128
Pharos: P10644(Tbio)
UniProt: P10644 B2R5T5
Structure
PDB: 

Jmol
Position
17q24.2
AA seq 381 aa AA seqDB search
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggcagtaccgccgccagtgaggaggcacgcagccttcgagaatgtgagctc
tacgtccagaagcataacattcaagcgctgctcaaagattctattgtgcagttgtgcact
gctcgacctgagagacccatggcattcctcagggaatactttgagaggttggagaaggag
gaggcaaaacagattcagaatctgcagaaagcaggcactcgtacagactcaagggaggat
gagatttctcctcctccacccaacccagtggttaaaggtaggaggcgacgaggtgctatc
agcgctgaggtctacacggaggaagatgcggcatcctatgttagaaaggttataccaaaa
gattacaagacaatggccgctttagccaaagccattgaaaagaatgtgctgttttcacat
cttgatgataatgagagaagtgatatttttgatgccatgttttcggtctcctttatcgca
ggagagactgtgattcagcaaggtgatgaaggggataacttctatgtgattgatcaagga
gagacggatgtctatgttaacaatgaatgggcaaccagtgttggggaaggagggagcttt
ggagaacttgctttgatttatggaacaccgagagcagccactgtcaaagcaaagacaaat
gtgaaattgtggggcatcgaccgagacagctatagaagaatcctcatgggaagcacactg
agaaagcggaagatgtatgaggaattccttagtaaagtctctattttagagtctctggac
aagtgggaacgtcttacggtagctgatgcattggaaccagtgcagtttgaagatgggcag
aagattgtggtgcagggagaaccaggggatgagttcttcattattttagaggggtcagct
gctgtgctacaacgtcggtcagaaaatgaagagtttgttgaagtgggaagattggggcct
tctgattattttggtgaaattgcactactgatgaatcgtcctcgtgctgccacagttgtt
gctcgtggccccttgaagtgcgttaagctggaccgacctagatttgaacgtgttcttggc
ccatgctcagacatcctcaaacgaaacatccagcagtacaacagttttgtgtcactgtct
gtctga

DBGET integrated database retrieval system