KEGG   Homo sapiens (human): 5575Help
Entry
5575              CDS       T01001                                 

Gene name
PRKAR1B, PRKAR1
Definition
(RefSeq) protein kinase cAMP-dependent type I regulatory subunit beta
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5575 (PRKAR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding RIIa
Motif
Other DBs
NCBI-GeneID: 5575
NCBI-ProteinID: NP_001158230
OMIM: 176911
HGNC: 9390
Ensembl: ENSG00000188191
Vega: OTTHUMG00000151411
Pharos: P31321(Tbio)
UniProt: P31321
Structure
PDB: 

Jmol
Position
7p22.3
AA seq 381 aa AA seqDB search
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccgcccgcctgcccctcggaggaggacgagagcctgaagggctgtgagctg
tacgtgcagctgcacgggatccagcaggtcctcaaagactgtatcgtccacctctgcatc
tccaagcccgaacgccccatgaagttcctccgggagcacttcgagaagctggagaaggaa
gaaaacaggcagattttggcgcggcaaaagtcaaactcacagtcggactcccatgatgag
gaggtgtcgcccacccccccgaaccctgtggtgaaggcccgccgccggcgaggaggcgtg
agtgccgaggtgtacaccgaggaggacgccgtgtcctacgtcaggaaggtgattcccaag
gactacaaaaccatgactgcgctggccaaggccatctccaagaacgtgctcttcgctcac
ctggatgacaacgagaggagtgacatattcgatgccatgttccctgtcactcacatcgct
ggggagactgttatacagcaagggaatgaaggagacaacttctatgtcgttgatcaaggg
gaagtggatgtgtacgtgaacggagagtgggtgaccaacatcagcgagggaggcagcttc
ggggagctggcgctcatctacggcacccccagggctgcgaccgtgaaagccaagacggac
ctcaagctctgggggatcgaccgggacagctaccggcgcatccttatgggcagcacgctg
aggaaacgcaagatgtacgaggagttcctcagcaaggtctccatcctagagtccctggag
aagtgggagcgtctgaccgtggcggatgcgctggagcccgtccagtttgaagatggagag
aaaattgtggtccagggagagcctggggacgacttttacatcatcacggagggcaccgcg
tccgtgctgcagcgccggtcccccaatgaggagtacgtggaggtggggcgcctgggaccc
tctgactacttcggggagattgcactgctgctgaaccggccccgggcggccactgtcgtg
gcccgggggcccctcaagtgtgtgaagctggaccggccccgcttcgagcgtgtgctgggg
ccctgctctgagatcctcaagaggaacattcagcgttacaacagcttcatctccctcacc
gtctga

DBGET integrated database retrieval system