KEGG   Homo sapiens (human): 5575Help
Entry
5575              CDS       T01001                                 

Gene name
PRKAR1B, PRKAR1
Definition
protein kinase, cAMP-dependent, regulatory, type I, beta (EC:2.7.11.1)
Orthology
K04739  
cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Insulin signaling pathway
Class
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p22
AA seq 381 aa AA seqDB search
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccgcccgcctgcccctcggaggaggacgagagcctgaagggctgtgagctg
tacgtgcagctgcacgggatccagcaggtcctcaaagactgtatcgtccacctctgcatc
tccaagcccgaacgccccatgaagttcctccgggagcacttcgagaagctggagaaggaa
gaaaacaggcagattttggcgcggcaaaagtcaaactcacagtcggactcccatgatgag
gaggtgtcgcccacccccccgaaccctgtggtgaaggcccgccgccggcgaggaggcgtg
agtgccgaggtgtacaccgaggaggacgccgtgtcctacgtcaggaaggtgattcccaag
gactacaaaaccatgactgcgctggccaaggccatctccaagaacgtgctcttcgctcac
ctggatgacaacgagaggagtgacatattcgatgccatgttccctgtcactcacatcgct
ggggagactgttatacagcaagggaatgaaggagacaacttctatgtcgttgatcaaggg
gaagtggatgtgtacgtgaacggagagtgggtgaccaacatcagcgagggaggcagcttc
ggggagctggcgctcatctacggcacccccagggctgcgaccgtgaaagccaagacggac
ctcaagctctgggggatcgaccgggacagctaccggcgcatccttatgggcagcacgctg
aggaaacgcaagatgtacgaggagttcctcagcaaggtctccatcctagagtccctggag
aagtgggagcgtctgaccgtggcggatgcgctggagcccgtccagtttgaagatggagag
aaaattgtggtccagggagagcctggggacgacttttacatcatcacggagggcaccgcg
tccgtgctgcagcgccggtcccccaatgaggagtacgtggaggtggggcgcctgggaccc
tctgactacttcggggagattgcactgctgctgaaccggccccgggcggccactgtcgtg
gcccgggggcccctcaagtgtgtgaagctggaccggccccgcttcgagcgtgtgctgggg
ccctgctctgagatcctcaagaggaacattcagcgttacaacagcttcatctccctcacc
gtctga

DBGET integrated database retrieval system