KEGG   Homo sapiens (human): 5577Help
Entry
5577              CDS       T01001                                 

Gene name
PRKAR2B, PRKAR2, RII-BETA
Definition
(RefSeq) protein kinase cAMP-dependent type II regulatory subunit beta
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5577 (PRKAR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding RIIa
Motif
Other DBs
NCBI-GeneID: 5577
NCBI-ProteinID: NP_002727
OMIM: 176912
HGNC: 9392
Ensembl: ENSG00000005249
Vega: OTTHUMG00000137418
Pharos: P31323(Tbio)
UniProt: P31323 A0A024R712 B3KY43
Position
7q22.3
AA seq 418 aa AA seqDB search
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgagatcccggcgggactgacggagctgctgcagggcttcacggtggaggtg
ctgaggcaccagcccgcggacctgctggagttcgcgctgcagcacttcacccgcctgcag
caggagaacgagcgcaaaggcaccgcgcgcttcggccatgagggcaggacctggggggac
ctgggcgccgctgccgggggcggcacccccagcaagggggtcaacttcgccgaggagccc
atgcagtccgactccgaggacggggaggaggaggaggcggcgcccgcggacgcaggggcg
ttcaatgctccagtaataaaccgattcacaaggcgtgcctcagtatgtgcagaagcttat
aatcctgatgaagaagaagatgatgcagagtccaggattatacatccaaaaactgatgat
caaagaaataggttgcaagaggcttgcaaagacatcctgctgtttaagaatctggatccg
gagcagatgtctcaagtattagatgccatgtttgaaaaattggtcaaagatggggagcat
gtaattgatcaaggtgacgatggtgacaacttttatgtaattgatagaggcacatttgat
atttatgtgaaatgtgatggtgttggaagatgtgttggtaactatgataatcgtgggagt
ttcggcgaactggccttaatgtacaatacacccagagcagctacaatcactgctacctct
cctggtgctctgtggggtttggacagggtaaccttcaggagaataattgtgaaaaacaat
gccaaaaagagaaaaatgtatgaaagctttattgagtcactgccattccttaaatctttg
gagttttctgaacgcctgaaagtagtagatgtgataggcaccaaagtatacaacgatgga
gaacaaatcattgctcagggagattcggctgattcttttttcattgtagaatctggagaa
gtgaaaattactatgaaaagaaagggtaaatcagaagtggaagagaatggtgcagtagaa
atcgctcgatgctcgcggggacagtactttggagagcttgccctggtaactaacaaacct
cgagcagcttctgcccacgccattgggactgtcaaatgtttagcaatggatgtgcaagca
tttgaaaggcttctgggaccttgcatggaaattatgaaaaggaacatcgctacctatgaa
gaacagttagttgccctgtttggaacgaacatggatattgttgaacccactgcatga

DBGET integrated database retrieval system