KEGG   Homo sapiens (human): 5577Help
Entry
5577              CDS       T01001                                 

Gene name
PRKAR2B, PRKAR2, RII-BETA
Definition
protein kinase, cAMP-dependent, regulatory, type II, beta (EC:2.7.11.1)
Orthology
K04739  
cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    5577 (PRKAR2B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5577 (PRKAR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22
AA seq 418 aa AA seqDB search
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgagatcccggcgggactgacggagctgctgcagggcttcacggtggaggtg
ctgaggcaccagcccgcggacctgctggagttcgcgctgcagcacttcacccgcctgcag
caggagaacgagcgcaaaggcaccgcgcgcttcggccatgagggcaggacctggggggac
ctgggcgccgctgccgggggcggcacccccagcaagggggtcaacttcgccgaggagccc
atgcagtccgactccgaggacggggaggaggaggaggcggcgcccgcggacgcaggggcg
ttcaatgctccagtaataaaccgattcacaaggcgtgcctcagtatgtgcagaagcttat
aatcctgatgaagaagaagatgatgcagagtccaggattatacatccaaaaactgatgat
caaagaaataggttgcaagaggcttgcaaagacatcctgctgtttaagaatctggatccg
gagcagatgtctcaagtattagatgccatgtttgaaaaattggtcaaagatggggagcat
gtaattgatcaaggtgacgatggtgacaacttttatgtaattgatagaggcacatttgat
atttatgtgaaatgtgatggtgttggaagatgtgttggtaactatgataatcgtgggagt
ttcggcgaactggccttaatgtacaatacacccagagcagctacaatcactgctacctct
cctggtgctctgtggggtttggacagggtaaccttcaggagaataattgtgaaaaacaat
gccaaaaagagaaaaatgtatgaaagctttattgagtcactgccattccttaaatctttg
gagttttctgaacgcctgaaagtagtagatgtgataggcaccaaagtatacaacgatgga
gaacaaatcattgctcagggagattcggctgattcttttttcattgtagaatctggagaa
gtgaaaattactatgaaaagaaagggtaaatcagaagtggaagagaatggtgcagtagaa
atcgctcgatgctcgcggggacagtactttggagagcttgccctggtaactaacaaacct
cgagcagcttctgcccacgccattgggactgtcaaatgtttagcaatggatgtgcaagca
tttgaaaggcttctgggaccttgcatggaaattatgaaaaggaacatcgctacctatgaa
gaacagttagttgccctgtttggaacgaacatggatattgttgaacccactgcatga

DBGET integrated database retrieval system