KEGG   Homo sapiens (human): 5578Help
Entry
5578              CDS       T01001                                 

Gene name
PRKCA, AAG6, PKC-alpha, PKCA, PRKACA
Definition
protein kinase C, alpha (EC:2.7.11.13)
Orthology
K02677  
classical protein kinase C [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Tight junction
Gap junction
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Amphetamine addiction
Morphine addiction
Vibrio cholerae infection
Pathogenic Escherichia coli infection
African trypanosomiasis
Amoebiasis
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5578 (PRKCA)
   04015 Rap1 signaling pathway
    5578 (PRKCA)
   04010 MAPK signaling pathway
    5578 (PRKCA)
   04012 ErbB signaling pathway
    5578 (PRKCA)
   04310 Wnt signaling pathway
    5578 (PRKCA)
   04370 VEGF signaling pathway
    5578 (PRKCA)
   04066 HIF-1 signaling pathway
    5578 (PRKCA)
   04020 Calcium signaling pathway
    5578 (PRKCA)
   04070 Phosphatidylinositol signaling system
    5578 (PRKCA)
   04151 PI3K-Akt signaling pathway
    5578 (PRKCA)
   04150 mTOR signaling pathway
    5578 (PRKCA)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    5578 (PRKCA)
   04530 Tight junction
    5578 (PRKCA)
   04540 Gap junction
    5578 (PRKCA)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5578 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    5578 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    5578 (PRKCA)
   04670 Leukocyte transendothelial migration
    5578 (PRKCA)
  Endocrine system
   04911 Insulin secretion
    5578 (PRKCA)
   04912 GnRH signaling pathway
    5578 (PRKCA)
   04921 Oxytocin signaling pathway
    5578 (PRKCA)
   04918 Thyroid hormone synthesis
    5578 (PRKCA)
   04919 Thyroid hormone signaling pathway
    5578 (PRKCA)
   04916 Melanogenesis
    5578 (PRKCA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5578 (PRKCA)
   04270 Vascular smooth muscle contraction
    5578 (PRKCA)
  Digestive system
   04970 Salivary secretion
    5578 (PRKCA)
   04971 Gastric acid secretion
    5578 (PRKCA)
   04972 Pancreatic secretion
    5578 (PRKCA)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5578 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5578 (PRKCA)
  Nervous system
   04724 Glutamatergic synapse
    5578 (PRKCA)
   04727 GABAergic synapse
    5578 (PRKCA)
   04725 Cholinergic synapse
    5578 (PRKCA)
   04728 Dopaminergic synapse
    5578 (PRKCA)
   04726 Serotonergic synapse
    5578 (PRKCA)
   04720 Long-term potentiation
    5578 (PRKCA)
   04730 Long-term depression
    5578 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    5578 (PRKCA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5578 (PRKCA)
  Environmental adaptation
   04713 Circadian entrainment
    5578 (PRKCA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5578 (PRKCA)
   05206 MicroRNAs in cancer
    5578 (PRKCA)
   05205 Proteoglycans in cancer
    5578 (PRKCA)
   05214 Glioma
    5578 (PRKCA)
   05223 Non-small cell lung cancer
    5578 (PRKCA)
  Substance dependence
   05031 Amphetamine addiction
    5578 (PRKCA)
   05032 Morphine addiction
    5578 (PRKCA)
  Infectious diseases
   05110 Vibrio cholerae infection
    5578 (PRKCA)
   05130 Pathogenic Escherichia coli infection
    5578 (PRKCA)
   05164 Influenza A
    5578 (PRKCA)
   05161 Hepatitis B
    5578 (PRKCA)
   05146 Amoebiasis
    5578 (PRKCA)
   05143 African trypanosomiasis
    5578 (PRKCA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5578 (PRKCA)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5578 (PRKCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q22-q23.2
AA seq 672 aa AA seqDB search
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccgcagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccggaaggggacgaggaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagagcatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgtggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccacct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

DBGET integrated database retrieval system