KEGG   Homo sapiens (human): 5578Help
Entry
5578              CDS       T01001                                 

Gene name
PRKCA, AAG6, PKC-alpha, PKCA, PRKACA
Definition
protein kinase C, alpha (EC:2.7.11.13)
Orthology
K02677  
classical protein kinase C [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Tight junction
Gap junction
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Amphetamine addiction
Morphine addiction
Vibrio cholerae infection
Pathogenic Escherichia coli infection
African trypanosomiasis
Amoebiasis
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q22-q23.2
AA seq 672 aa AA seqDB search
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccgcagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccggaaggggacgaggaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagagcatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgtggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccacct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

DBGET integrated database retrieval system