KEGG   Homo sapiens (human): 5580Help
Entry
5580              CDS       T01001                                 

Gene name
PRKCD, ALPS3, CVID9, MAY1, PKCD, nPKC-delta
Definition
(RefSeq) protein kinase C delta
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04140  Autophagy - animal
hsa04270  Vascular smooth muscle contraction
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04722  Neurotrophin signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
Drug target
Delcasertib (DG02094): D10456 D10457
Safingol: D05784
Safingol hydrochloride: D05785
Sotrastaurin (DG01406): D09671 D09718
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5580 (PRKCD)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    5580 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    5580 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    5580 (PRKCD)
   04062 Chemokine signaling pathway
    5580 (PRKCD)
  Endocrine system
   04912 GnRH signaling pathway
    5580 (PRKCD)
   04915 Estrogen signaling pathway
    5580 (PRKCD)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5580 (PRKCD)
  Nervous system
   04722 Neurotrophin signaling pathway
    5580 (PRKCD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5580 (PRKCD)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5580 (PRKCD)
   04931 Insulin resistance
    5580 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5580 (PRKCD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5580 (PRKCD)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   5580 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 Kinase-like zf-RING-like Zf_RING Haspin_kinase PHD zf-RING_9 DZR APH FYVE_2 DUF2318
Motif
Other DBs
NCBI-GeneID: 5580
NCBI-ProteinID: NP_001303256
OMIM: 176977
HGNC: 9399
Ensembl: ENSG00000163932
Vega: OTTHUMG00000133659
Pharos: Q05655(Tclin)
UniProt: Q05655 B4DFV1 A0A024R328
Structure
PDB: 

Jmol
Position
3p21.1
AA seq 676 aa AA seqDB search
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgttcctgcgcatcgccttcaactcctatgagctgggctccctgcaggccgag
gacgaggcgaaccagcccttctgtgccgtgaagatgaaggaggcgctcagcacagagcgt
gggaaaacactggtgcagaagaagccgaccatgtatcctgagtggaagtcgacgttcgat
gcccacatctatgaggggcgcgtcatccagattgtgctaatgcgggcagcagaggagcca
gtgtctgaggtgaccgtgggtgtgtcggtgctggccgagcgctgcaagaagaacaatggc
aaggctgagttctggctggacctgcagcctcaggccaaggtgttgatgtctgttcagtat
ttcctggaggacgtggattgcaaacagtctatgcgcagtgaggacgaggccaagttccca
acgatgaaccgccgcggagccatcaaacaggccaaaatccactacatcaagaaccatgag
tttatcgccaccttctttgggcaacccaccttctgttctgtgtgcaaagactttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgtaacgctgccatccacaagaaatgc
atcgacaagatcatcggcagatgcactggcaccgcggccaacagccgggacactatattc
cagaaagaacgcttcaacatcgacatgccgcaccgcttcaaggttcacaactacatgagc
cccaccttctgtgaccactgcggcagcctgctctggggactggtgaagcagggattaaag
tgtgaagactgcggcatgaatgtgcaccataaatgccgggagaaggtggccaacctctgc
ggcatcaaccagaagcttttggctgaggccttgaaccaagtcacccagagagcctcccgg
agatcagactcagcctcctcagagcctgttgggatatatcagggtttcgagaagaagacc
ggagttgctggggaggacatgcaagacaacagtgggacctacggcaagatctgggagggc
agcagcaagtgcaacatcaacaacttcatcttccacaaggtcctgggcaaaggcagcttc
gggaaggtgctgcttggagagctgaagggcagaggagagtactttgccatcaaggccctc
aagaaggatgtggtcctgatcgacgacgacgtggagtgcaccatggttgagaagcgggtg
ctgacacttgccgcagagaatccctttctcacccacctcatctgcaccttccagaccaag
gaccacctgttctttgtgatggagttcctcaacgggggggacctgatgtaccacatccag
gacaaaggccgctttgaactctaccgtgccacgttttatgccgctgagataatgtgtgga
ctgcagtttctacacagcaagggcatcatttacagggacctcaaactggacaatgtgctg
ctggaccgggatggccacatcaagattgccgactttgggatgtgcaaagagaacatattc
ggggagagccgggccagcaccttctgcggcacccctgactatatcgcccctgagatccta
cagggcctgaagtacacattctctgtggactggtggtctttcggggtccttctgtacgag
atgctcattggccagtcccccttccatggtgatgatgaggatgaactcttcgagtccatc
cgtgtggacacgccacattatccccgctggatcaccaaggagtccaaggacatcctggag
aagctctttgaaagggaaccaaccaagaggctgggagtgaccggaaacatcaaaatccac
cccttcttcaagaccataaactggactctgctggaaaagcggaggttggagccacctttc
aggcccaaagtgaagtcacccagagactacagtaactttgaccaggagttcctgaacgag
aaggcgcgcctctcctacagcgacaagaacctcatcgactccatggaccagtctgcattc
gctggcttctcctttgtgaaccccaaattcgagcacctcctggaagattga

DBGET integrated database retrieval system