KEGG   Homo sapiens (human): 55800Help
Entry
55800             CDS       T01001                                 

Gene name
SCN3B, ATFB16, BRGDA7, HSA243396, SCNB3
Definition
(RefSeq) sodium voltage-gated channel beta subunit 3
  KO
K04847  voltage-gated sodium channel type III beta
Organism
hsa  Homo sapiens (human)
Disease
H00728  Brugada syndrome (BRS)
H00731  Atrial fibrillation
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN beta
   55800 (SCN3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set OAD_gamma Ac76
Motif
Other DBs
NCBI-GeneID: 55800
NCBI-ProteinID: NP_001035241
OMIM: 608214
HGNC: 20665
Ensembl: ENSG00000166257
Vega: OTTHUMG00000166006
Pharos: Q9NY72(Tbio)
UniProt: Q9NY72 A0A024R3H7
Structure
PDB: 

Jmol
Position
11q24.1
AA seq 215 aa AA seqDB search
MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccttcaatagattgtttcccctggcttctctcgtgcttatctactgggtcagt
gtctgcttccctgtgtgtgtggaagtgccctcggagacggaggccgtgcagggcaacccc
atgaagctgcgctgcatctcctgcatgaagagagaggaggtggaggccaccacggtggtg
gaatggttctacaggcccgagggcggtaaagatttccttatttacgagtatcggaatggc
caccaggaggtggagagcccctttcaggggcgcctgcagtggaatggcagcaaggacctg
caggacgtgtccatcactgtgctcaacgtcactctgaacgactctggcctctacacctgc
aatgtgtcccgggagtttgagtttgaggcgcatcggccctttgtgaagacgacgcggctg
atccccctaagagtcaccgaggaggctggagaggacttcacctctgtggtctcagaaatc
atgatgtacatccttctggtcttcctcaccttgtggctgctcatcgagatgatatattgc
tacagaaaggtctcaaaagccgaagaggcagcccaagaaaacgcgtctgactaccttgcc
atcccatctgagaacaaggagaactctgcggtaccagtggaggaatag

DBGET integrated database retrieval system