KEGG   Homo sapiens (human): 55800Help
Entry
55800             CDS       T01001                                 

Gene name
SCN3B, ATFB16, BRGDA7, HSA243396, SCNB3
Definition
(RefSeq) sodium voltage-gated channel beta subunit 3
  KO
K04847  
voltage-gated sodium channel type III beta
Organism
hsa  Homo sapiens (human)
Disease
H00728  
Brugada syndrome (BRS)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN beta
   55800 (SCN3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 215 aa AA seqDB search
MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccttcaatagattgtttcccctggcttctctcgtgcttatctactgggtcagt
gtctgcttccctgtgtgtgtggaagtgccctcggagacggaggccgtgcagggcaacccc
atgaagctgcgctgcatctcctgcatgaagagagaggaggtggaggccaccacggtggtg
gaatggttctacaggcccgagggcggtaaagatttccttatttacgagtatcggaatggc
caccaggaggtggagagcccctttcaggggcgcctgcagtggaatggcagcaaggacctg
caggacgtgtccatcactgtgctcaacgtcactctgaacgactctggcctctacacctgc
aatgtgtcccgggagtttgagtttgaggcgcatcggccctttgtgaagacgacgcggctg
atccccctaagagtcaccgaggaggctggagaggacttcacctctgtggtctcagaaatc
atgatgtacatccttctggtcttcctcaccttgtggctgctcatcgagatgatatattgc
tacagaaaggtctcaaaagccgaagaggcagcccaagaaaacgcgtctgactaccttgcc
atcccatctgagaacaaggagaactctgcggtaccagtggaggaatag

DBGET integrated database retrieval system