KEGG   Homo sapiens (human): 5581Help
Entry
5581              CDS       T01001                                 

Gene name
PRKCE, PKCE, nPKC-epsilon
Definition
protein kinase C, epsilon (EC:2.7.11.13)
Orthology
K18050  
novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Tight junction
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Inflammatory mediator regulation of TRP channels
Type II diabetes mellitus
MicroRNAs in cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    5581 (PRKCE)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    5581 (PRKCE)
 Organismal Systems
  Immune system
   04664 Fc epsilon RI signaling pathway
    5581 (PRKCE)
   04666 Fc gamma R-mediated phagocytosis
    5581 (PRKCE)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5581 (PRKCE)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5581 (PRKCE)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    5581 (PRKCE)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5581 (PRKCE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5581 (PRKCE)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5581 (PRKCE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21
AA seq 737 aa AA seqDB search
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccgcagactttccttctcgacccc
tacattgccctcaatgtggacgactcgcgcatcggccaaacggccaccaagcagaagacc
aacagcccggcctggcacgacgagttcgtcaccgatgtgtgcaacggacgcaagatcgag
ctggctgtctttcacgatgcccccataggctacgacgacttcgtggccaactgcaccatc
cagtttgaggagctgctgcagaacgggagccgccacttcgaggactggattgatctggag
ccagaaggaagagtgtatgtgatcatcgatctctcagggtcgtcgggtgaagcccctaaa
gacaatgaagagcgtgtgttcagggaacgcatgcggccgaggaagcggcagggggccgtc
aggcgcagggtccatcaggtcaacggccacaagttcatggccacctatcttcggcagccc
acctactgctcccattgcagagacttcatctggggtgtcataggaaagcagggataccag
tgtcaagtctgcacctgcgtggtccacaagcggtgccacgagctcataatcacaaagtgt
gctgggttaaagaagcaggagacccccgaccaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcggtatccacaactacaaggtccctaccttctgcgatcactgtggg
tccctgctctggggactcttgcggcagggtttgcagtgtaaagtctgcaaaatgaatgtt
caccgtcgatgtgagaccaacgtggctcccaactgtggagtggatgccagaggaatcgcc
aaagtactggccgacctgggcgttaccccagacaaaatcaccaacagcggccagagaagg
aaaaagctcattgctggtgccgagtccccgcagcctgcttctggaagctcaccatctgag
gaagatcgatccaagtcagcacccacctccccttgtgaccaggaaataaaagaacttgag
aacaacattcggaaagccttgtcatttgacaaccgaggagaggagcaccgggcagcatcg
tctcctgatggccagctgatgagccccggtgagaatggcgaagtccggcaaggccaggcc
aagcgcctgggcctggatgagttcaacttcatcaaggtgttgggcaaaggcagctttggc
aaggtcatgttggcagaactcaagggcaaagatgaagtatatgctgtgaaggtcttaaag
aaggacgtcatccttcaggatgatgacgtggactgcacaatgacagagaagaggattttg
gctctggcacggaaacacccgtaccttacccaactctactgctgcttccagaccaaggac
cgcctctttttcgtcatggaatatgtaaatggtggagacctcatgtttcagattcagcgc
tcccgaaaattcgacgagcctcgttcacggttctatgctgcagaggtcacatcggccctc
atgttcctccaccagcatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggctgacttcgggatgtgcaaggaagggattctgaat
ggtgtgacgaccaccacgttctgtgggactcctgactacatagctcctgagatcctgcag
gagttggagtatggcccctccgtggactggtgggccctgggggtgctgatgtacgagatg
atggctggacagcctccctttgaggccgacaatgaggacgacctatttgagtccatcctc
catgacgacgtgctgtacccagtctggctcagcaaggaggctgtcagcatcttgaaagct
ttcatgacgaagaatccccacaagcgcctgggctgtgtggcatcgcagaatggcgaggac
gccatcaagcagcacccattcttcaaagagattgactgggtgctcctggagcagaagaag
atcaagccacccttcaaaccacgcattaaaaccaaaagagacgtcaataattttgaccaa
gactttacccgggaagagccggtactcacccttgtggacgaagcaattgtaaagcagatc
aaccaggaggaattcaaaggtttctcctactttggtgaagacctgatgccctga

DBGET integrated database retrieval system