KEGG   Homo sapiens (human): 55813Help
Entry
55813             CDS       T01001                                 

Gene name
UTP6, C17orf40, HCA66
Definition
(RefSeq) UTP6, small subunit processome component
  KO
K14557  
U3 small nucleolar RNA-associated protein 6
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55813 (UTP6)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    55813 (UTP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9NYH9(Tbio)
UniProt: 
Position
17q11.2
AA seq 597 aa AA seqDB search
MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQY
EINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKW
ATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYK
EYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHV
SLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV
EVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKRLERTMTVFRK
AHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFRDSGTMWQLKLQVLIESKSPD
IAMLFEEAFVHLKPQVCLPLWISWAEWSEGAKSQEDTEAVFKKALLAVIGADSVTLKNKY
LDWAYRSGGYKKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREF
GSADSDLWMDYMKEELNHPLGRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcagagataattcaggaacgcatagaagatcggctcccggaattggaacagctggag
cgcattggactgttcagtcatgcggagattaaggctatcattaagaaggcttccgatcta
gagtacaaaatccagagaagaacccttttcaaggaagactttatcaattatgttcaatat
gaaattaatcttttggagctgatccagagaagaagaacacgcattggatattcatttaag
aaggatgagattgagaattctattgtacaccgggtacaaggtgttttccagcgtgcctca
gcaaaatggaaagacgatgttcaactttggctctcctatgtggctttttgtaagaagtgg
gctactaaaactcgacttagcaaggtattctctgccatgttggcgattcattccaacaaa
ccagctttgtggattatggcagccaaatgggaaatggaagatcgattgtcttcagaaagc
gcaaggcaactatttcttcgcgcactgcgctttcatccagagtgcccaaaactttataaa
gaatactttaggatggagctgatgcatgctgaaaaactgaggaaggagaaggaagaattt
gaaaaagccagtatggatgtggagaatcctgattattctgaagaaatccttaagggcgag
ttggcatggatcatctacaaaaattctgtaagcataattaaaggtgcagaatttcacgtg
tcactgctttcgattgcacagctatttgactttgccaaagatctacaaaaagagatttat
gatgaccttcaggctctacacacagatgatcctctcacttgggattatgtggcaaggcga
gaattagagattgagtcacagacagaagagcagcctacaacgaaacaagccaaagcagtg
gaggtcggccggaaggaggagaggtgctgtgctgtgtatgaagaggcagtgaagactctg
ccaacagaggccatgtggaagtgttacatcaccttttgcttggaaagatttactaagaag
tcaaatagtgggttccttagagggaagaggttggaaagaaccatgactgtattcaggaag
gcacatgaactgaagcttctgtcagaatgccaatacaagcagttgagtgtttcgttgctg
tgttataacttcctgagggaagctctggaagtggcagtagctggaactgaattgtttaga
gactctgggacaatgtggcagctgaagctgcaggtgctgatcgagtcaaagagccctgac
atagccatgctttttgaagaagcctttgtgcacctgaaaccccaggtttgtctgccattg
tggatttcctgggcagagtggagtgaaggtgccaaaagccaagaagacactgaggcagtc
tttaagaaagctctcttagctgtcataggtgccgactcagtaaccctgaagaataagtac
ctggattgggcttatcgaagtggtggctacaaaaaggccagagctgtgtttaaaagttta
caggagagccgaccattttcagttgactttttcaggaaaatgattcagtttgaaaaggag
caagaatcctgcaatatggcgaacataagagaatattatgagagagctttgagagagttt
ggatccgcagattctgatctttggatggattatatgaaagaagaattgaaccaccccctt
ggtagacctgagaactgtggacagatctactggcgagcgatgaaaatgttgcagggagag
tcagcagaggcatttgtagctaaacatgctatgcatcagactggccatttatga

DBGET integrated database retrieval system