KEGG   Homo sapiens (human): 5582Help
Entry
5582              CDS       T01001                                 

Gene name
PRKCG, PKC-gamma, PKCC, PKCG, SCA14
Definition
protein kinase C, gamma (EC:2.7.11.13)
Orthology
K02677  
classical protein kinase C [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Vascular smooth muscle contraction
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Tight junction
Gap junction
Natural killer cell mediated cytotoxicity
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Amphetamine addiction
Morphine addiction
Vibrio cholerae infection
African trypanosomiasis
Amoebiasis
Hepatitis B
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5582 (PRKCG)
   04015 Rap1 signaling pathway
    5582 (PRKCG)
   04010 MAPK signaling pathway
    5582 (PRKCG)
   04012 ErbB signaling pathway
    5582 (PRKCG)
   04310 Wnt signaling pathway
    5582 (PRKCG)
   04370 VEGF signaling pathway
    5582 (PRKCG)
   04066 HIF-1 signaling pathway
    5582 (PRKCG)
   04020 Calcium signaling pathway
    5582 (PRKCG)
   04070 Phosphatidylinositol signaling system
    5582 (PRKCG)
   04150 mTOR signaling pathway
    5582 (PRKCG)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    5582 (PRKCG)
   04530 Tight junction
    5582 (PRKCG)
   04540 Gap junction
    5582 (PRKCG)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5582 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    5582 (PRKCG)
   04670 Leukocyte transendothelial migration
    5582 (PRKCG)
  Endocrine system
   04911 Insulin secretion
    5582 (PRKCG)
   04921 Oxytocin signaling pathway
    5582 (PRKCG)
   04918 Thyroid hormone synthesis
    5582 (PRKCG)
   04919 Thyroid hormone signaling pathway
    5582 (PRKCG)
   04916 Melanogenesis
    5582 (PRKCG)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5582 (PRKCG)
  Digestive system
   04970 Salivary secretion
    5582 (PRKCG)
   04971 Gastric acid secretion
    5582 (PRKCG)
   04972 Pancreatic secretion
    5582 (PRKCG)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5582 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5582 (PRKCG)
  Nervous system
   04724 Glutamatergic synapse
    5582 (PRKCG)
   04727 GABAergic synapse
    5582 (PRKCG)
   04725 Cholinergic synapse
    5582 (PRKCG)
   04728 Dopaminergic synapse
    5582 (PRKCG)
   04726 Serotonergic synapse
    5582 (PRKCG)
   04720 Long-term potentiation
    5582 (PRKCG)
   04730 Long-term depression
    5582 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    5582 (PRKCG)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5582 (PRKCG)
  Environmental adaptation
   04713 Circadian entrainment
    5582 (PRKCG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5582 (PRKCG)
   05206 MicroRNAs in cancer
    5582 (PRKCG)
   05205 Proteoglycans in cancer
    5582 (PRKCG)
   05214 Glioma
    5582 (PRKCG)
   05223 Non-small cell lung cancer
    5582 (PRKCG)
  Substance dependence
   05031 Amphetamine addiction
    5582 (PRKCG)
   05032 Morphine addiction
    5582 (PRKCG)
  Infectious diseases
   05110 Vibrio cholerae infection
    5582 (PRKCG)
   05161 Hepatitis B
    5582 (PRKCG)
   05146 Amoebiasis
    5582 (PRKCG)
   05143 African trypanosomiasis
    5582 (PRKCG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5582 (PRKCG)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5582 (PRKCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.4
AA seq 697 aa AA seqDB search
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctgggccccggcgtaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggccctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaaa
cacaagttccgcctgcatagctacagcagccccaccttctgcgaccactgtggctccctc
ctctacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcgggcgc
ctgcagctggagatccgggctcccacagcagatgagatccacgtaactgttggcgaggcc
cgtaacctaattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagacccgaacggtgaaagccacgctaaac
cctgtgtggaatgagacctttgtgttcaacctgaagccaggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggggccatgtcc
tttggcgtctcggagctgctcaaggcgcccgtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcgagtccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctctgatgagctctacgccatcaag
atcttgaaaaaggacgtgatcgtccaggacgacgatgtggactgcacgctggtggagaaa
cgtgtgctggcgctggggggccggggtcctggcggccggccccacttcctcacccagctc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtacgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcggcagaaatcgctatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgactttggc
atgtgtaaggagaacgtcttccccgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgag
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggag
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttc
gtgcacccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system