KEGG   Homo sapiens (human): 5583Help
Entry
5583              CDS       T01001                                 

Gene name
PRKCH, PKC-L, PKCL, PRKCL, nPKC-eta
Definition
protein kinase C, eta (EC:2.7.11.13)
Orthology
K18051  
novel protein kinase C eta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Tight junction
Inflammatory mediator regulation of TRP channels
Drug target
Other: 
Class
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.1
AA seq 683 aa AA seqDB search
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctggcaccatgaagttcaatggctatttgagggtccgcatcggtgaggcagtg
gggctgcagcccacccgctggtccctgcgccactcgctcttcaagaagggccaccagctg
ctggacccctatctgacggtgagcgtggaccaggtgcgcgtgggccagaccagcaccaag
cagaagaccaacaaacccacgtacaacgaggagttttgcgctaacgtcaccgacggcggc
cacctcgagttggccgtcttccacgagacgcccctgggctacgaccacttcgtggccaac
tgcaccctgcagttccaggagctgctgcgcacgaccggcgcctcggacaccttcgagggt
tgggtggatctcgagccagaggggaaagtatttgtggtaataacccttaccgggagtttc
actgaagctactctccagagagaccggatcttcaaacattttaccaggaagcgccaaagg
gctatgcgaaggcgagtccaccagatcaatggacacaagttcatggccacgtatctgagg
cagcccacctactgctctcactgcagggagtttatctggggagtgtttgggaaacagggt
tatcagtgccaagtgtgcacctgtgtcgtccataaacgctgccatcatctaattgttaca
gcctgtacttgccaaaacaatattaacaaagtggattcaaagattgcagaacagaggttc
gggatcaacatcccacacaagttcagcatccacaactacaaagtgccaacattctgcgat
cactgtggctcactgctctggggaataatgcgacaaggacttcagtgtaaaatatgtaaa
atgaatgtgcatattcgatgtcaagcgaacgtggcccctaactgtggggtaaatgcggtg
gaacttgccaagaccctggcagggatgggtctccaacccggaaatatttctccaacctcg
aaactcgtttccagatcgaccctaagacgacagggaaaggagagcagcaaagaaggaaat
gggattggggttaattcttccaaccgacttggtatcgacaactttgagttcatccgagtg
ttggggaaggggagttttgggaaggtgatgcttgcaagagtaaaagaaacaggagacctc
tatgctgtgaaggtgctgaagaaggacgtgattctgcaggatgatgatgtggaatgcacc
atgaccgagaaaaggatcctgtctctggcccgcaatcaccccttcctcactcagttgttc
tgctgctttcagacccccgatcgtctgttttttgtgatggagtttgtgaatgggggtgac
ttgatgttccacattcagaagtctcgtcgttttgatgaagcacgagctcgcttctatgct
gcagaaatcatttcggctctcatgttcctccatgataaaggaatcatctatagagatctg
aaactggacaatgtcctgttggaccacgagggtcactgtaaactggcagacttcggaatg
tgcaaggaggggatttgcaatggtgtcaccacggccacattctgtggcacgccagactat
atcgctccagagatcctccaggaaatgctgtacgggcctgcagtagactggtgggcaatg
ggcgtgttgctctatgagatgctctgtggtcacgcgccttttgaggcagagaacgaagat
gacctctttgaggccatactgaatgatgaggtggtctaccctacctggctccatgaagat
gccacagggatcctaaaatctttcatgaccaagaaccccaccatgcgcttgggcagcctg
actcagggaggcgagcacgccatcttgagacatcctttttttaaggaaatcgactgggcc
cagctgaaccatcgccaaatagaaccgcctttcagacccagaatcaaatcccgagaagat
gtcagtaattttgaccctgacttcataaaggaagagccagttttaactccaattgatgag
ggacatcttccaatgattaaccaggatgagtttagaaacttttcctatgtgtctccagaa
ttgcaaccatag

DBGET integrated database retrieval system