KEGG   Homo sapiens (human): 5583Help
Entry
5583              CDS       T01001                                 

Gene name
PRKCH, PKC-L, PKCL, PRKCL, nPKC-eta
Definition
protein kinase C, eta (EC:2.7.11.13)
Orthology
K18051  
novel protein kinase C eta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Tight junction
Inflammatory mediator regulation of TRP channels
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    5583 (PRKCH)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    5583 (PRKCH)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5583 (PRKCH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5583 (PRKCH)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5583 (PRKCH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5583 (PRKCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.1
AA seq 683 aa AA seqDB search
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctggcaccatgaagttcaatggctatttgagggtccgcatcggtgaggcagtg
gggctgcagcccacccgctggtccctgcgccactcgctcttcaagaagggccaccagctg
ctggacccctatctgacggtgagcgtggaccaggtgcgcgtgggccagaccagcaccaag
cagaagaccaacaaacccacgtacaacgaggagttttgcgctaacgtcaccgacggcggc
cacctcgagttggccgtcttccacgagacgcccctgggctacgaccacttcgtggccaac
tgcaccctgcagttccaggagctgctgcgcacgaccggcgcctcggacaccttcgagggt
tgggtggatctcgagccagaggggaaagtatttgtggtaataacccttaccgggagtttc
actgaagctactctccagagagaccggatcttcaaacattttaccaggaagcgccaaagg
gctatgcgaaggcgagtccaccagatcaatggacacaagttcatggccacgtatctgagg
cagcccacctactgctctcactgcagggagtttatctggggagtgtttgggaaacagggt
tatcagtgccaagtgtgcacctgtgtcgtccataaacgctgccatcatctaattgttaca
gcctgtacttgccaaaacaatattaacaaagtggattcaaagattgcagaacagaggttc
gggatcaacatcccacacaagttcagcatccacaactacaaagtgccaacattctgcgat
cactgtggctcactgctctggggaataatgcgacaaggacttcagtgtaaaatatgtaaa
atgaatgtgcatattcgatgtcaagcgaacgtggcccctaactgtggggtaaatgcggtg
gaacttgccaagaccctggcagggatgggtctccaacccggaaatatttctccaacctcg
aaactcgtttccagatcgaccctaagacgacagggaaaggagagcagcaaagaaggaaat
gggattggggttaattcttccaaccgacttggtatcgacaactttgagttcatccgagtg
ttggggaaggggagttttgggaaggtgatgcttgcaagagtaaaagaaacaggagacctc
tatgctgtgaaggtgctgaagaaggacgtgattctgcaggatgatgatgtggaatgcacc
atgaccgagaaaaggatcctgtctctggcccgcaatcaccccttcctcactcagttgttc
tgctgctttcagacccccgatcgtctgttttttgtgatggagtttgtgaatgggggtgac
ttgatgttccacattcagaagtctcgtcgttttgatgaagcacgagctcgcttctatgct
gcagaaatcatttcggctctcatgttcctccatgataaaggaatcatctatagagatctg
aaactggacaatgtcctgttggaccacgagggtcactgtaaactggcagacttcggaatg
tgcaaggaggggatttgcaatggtgtcaccacggccacattctgtggcacgccagactat
atcgctccagagatcctccaggaaatgctgtacgggcctgcagtagactggtgggcaatg
ggcgtgttgctctatgagatgctctgtggtcacgcgccttttgaggcagagaacgaagat
gacctctttgaggccatactgaatgatgaggtggtctaccctacctggctccatgaagat
gccacagggatcctaaaatctttcatgaccaagaaccccaccatgcgcttgggcagcctg
actcagggaggcgagcacgccatcttgagacatcctttttttaaggaaatcgactgggcc
cagctgaaccatcgccaaatagaaccgcctttcagacccagaatcaaatcccgagaagat
gtcagtaattttgaccctgacttcataaaggaagagccagttttaactccaattgatgag
ggacatcttccaatgattaaccaggatgagtttagaaacttttcctatgtgtctccagaa
ttgcaaccatag

DBGET integrated database retrieval system