KEGG   Homo sapiens (human): 5583Help
Entry
5583              CDS       T01001                                 

Gene name
PRKCH, PKC-L, PKCL, PRKCL, nPKC-eta
Definition
(RefSeq) protein kinase C eta
  KO
K18051  
novel protein kinase C eta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Inflammatory mediator regulation of TRP channels
Drug target
Sotrastaurin (DG01406): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    5583 (PRKCH)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5583 (PRKCH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5583 (PRKCH)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5583 (PRKCH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5583 (PRKCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P24723(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.1
AA seq 683 aa AA seqDB search
MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctggcaccatgaagttcaatggctatttgagggtccgcatcggtgaggcagtg
gggctgcagcccacccgctggtccctgcgccactcgctcttcaagaagggccaccagctg
ctggacccctatctgacggtgagcgtggaccaggtgcgcgtgggccagaccagcaccaag
cagaagaccaacaaacccacgtacaacgaggagttttgcgctaacgtcaccgacggcggc
cacctcgagttggccgtcttccacgagacgcccctgggctacgaccacttcgtggccaac
tgcaccctgcagttccaggagctgctgcgcacgaccggcgcctcggacaccttcgagggt
tgggtggatctcgagccagaggggaaagtatttgtggtaataacccttaccgggagtttc
actgaagctactctccagagagaccggatcttcaaacattttaccaggaagcgccaaagg
gctatgcgaaggcgagtccaccagatcaatggacacaagttcatggccacgtatctgagg
cagcccacctactgctctcactgcagggagtttatctggggagtgtttgggaaacagggt
tatcagtgccaagtgtgcacctgtgtcgtccataaacgctgccatcatctaattgttaca
gcctgtacttgccaaaacaatattaacaaagtggattcaaagattgcagaacagaggttc
gggatcaacatcccacacaagttcagcatccacaactacaaagtgccaacattctgcgat
cactgtggctcactgctctggggaataatgcgacaaggacttcagtgtaaaatatgtaaa
atgaatgtgcatattcgatgtcaagcgaacgtggcccctaactgtggggtaaatgcggtg
gaacttgccaagaccctggcagggatgggtctccaacccggaaatatttctccaacctcg
aaactcgtttccagatcgaccctaagacgacagggaaaggagagcagcaaagaaggaaat
gggattggggttaattcttccaaccgacttggtatcgacaactttgagttcatccgagtg
ttggggaaggggagttttgggaaggtgatgcttgcaagagtaaaagaaacaggagacctc
tatgctgtgaaggtgctgaagaaggacgtgattctgcaggatgatgatgtggaatgcacc
atgaccgagaaaaggatcctgtctctggcccgcaatcaccccttcctcactcagttgttc
tgctgctttcagacccccgatcgtctgttttttgtgatggagtttgtgaatgggggtgac
ttgatgttccacattcagaagtctcgtcgttttgatgaagcacgagctcgcttctatgct
gcagaaatcatttcggctctcatgttcctccatgataaaggaatcatctatagagatctg
aaactggacaatgtcctgttggaccacgagggtcactgtaaactggcagacttcggaatg
tgcaaggaggggatttgcaatggtgtcaccacggccacattctgtggcacgccagactat
atcgctccagagatcctccaggaaatgctgtacgggcctgcagtagactggtgggcaatg
ggcgtgttgctctatgagatgctctgtggtcacgcgccttttgaggcagagaacgaagat
gacctctttgaggccatactgaatgatgaggtggtctaccctacctggctccatgaagat
gccacagggatcctaaaatctttcatgaccaagaaccccaccatgcgcttgggcagcctg
actcagggaggcgagcacgccatcttgagacatcctttttttaaggaaatcgactgggcc
cagctgaaccatcgccaaatagaaccgcctttcagacccagaatcaaatcccgagaagat
gtcagtaattttgaccctgacttcataaaggaagagccagttttaactccaattgatgag
ggacatcttccaatgattaaccaggatgagtttagaaacttttcctatgtgtctccagaa
ttgcaaccatag

DBGET integrated database retrieval system