KEGG   Homo sapiens (human): 5584Help
Entry
5584              CDS       T01001                                 

Gene name
PRKCI, DXS1179E, PKCI, nPKC-iota
Definition
protein kinase C, iota (EC:2.7.11.13)
Orthology
K06069  
atypical protein kinase C [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Endocytosis
Hippo signaling pathway
Tight junction
Platelet activation
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5584 (PRKCI)
   04390 Hippo signaling pathway
    5584 (PRKCI)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5584 (PRKCI)
  Cellular commiunity
   04530 Tight junction
    5584 (PRKCI)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5584 (PRKCI)
  Endocrine system
   04910 Insulin signaling pathway
    5584 (PRKCI)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5584 (PRKCI)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5584 (PRKCI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.3
AA seq 596 aa AA seqDB search
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccagagggacagcagcaccatgtcccacacggtcgcaggcggcggcagcggg
gaccattcccaccaggtccgggtgaaagcctactaccgcggggatatcatgataacacat
tttgaaccttccatctcctttgagggcctttgcaatgaggttcgagacatgtgttctttt
gacaacgaacagctcttcaccatgaaatggatagatgaggaaggagacccgtgtacagta
tcatctcagttggagttagaagaagcctttagactttatgagctaaacaaggattctgaa
ctcttgattcatgtgttcccttgtgtaccagaacgtcctgggatgccttgtccaggagaa
gataaatccatctaccgtagaggtgcacgccgctggagaaagctttattgtgccaatggc
cacactttccaagccaagcgtttcaacaggcgtgctcactgtgccatctgcacagaccga
atatggggacttggacgccaaggatataagtgcatcaactgcaaactcttggttcataag
aagtgccataaactcgtcacaattgaatgtgggcggcattctttgccacaggaaccagtg
atgcccatggatcagtcatccatgcattctgaccatgcacagacagtaattccatataat
ccttcaagtcatgagagtttggatcaagttggtgaagaaaaagaggcaatgaacaccagg
gaaagtggcaaagcttcatccagtctaggtcttcaggattttgatttgctccgggtaata
ggaagaggaagttatgccaaagtactgttggttcgattaaaaaaaacagatcgtatttat
gcaatgaaagttgtgaaaaaagagcttgttaatgatgatgaggatattgattgggtacag
acagagaagcatgtgtttgagcaggcatccaatcatcctttccttgttgggctgcattct
tgctttcagacagaaagcagattgttctttgttatagagtatgtaaatggaggagaccta
atgtttcatatgcagcgacaaagaaaacttcctgaagaacatgccagattttactctgca
gaaatcagtctagcattaaattatcttcatgagcgagggataatttatagagatttgaaa
ctggacaatgtattactggactctgaaggccacattaaactcactgactacggcatgtgt
aaggaaggattacggccaggagatacaaccagcactttctgtggtactcctaattacatt
gctcctgaaattttaagaggagaagattatggtttcagtgttgactggtgggctcttgga
gtgctcatgtttgagatgatggcaggaaggtctccatttgatattgttgggagctccgat
aaccctgaccagaacacagaggattatctcttccaagttattttggaaaaacaaattcgc
ataccacgttctctgtctgtaaaagctgcaagtgttctgaagagttttcttaataaggac
cctaaggaacgattgggttgtcatcctcaaacaggatttgctgatattcagggacacccg
ttcttccgaaatgttgattgggatatgatggagcaaaaacaggtggtacctccctttaaa
ccaaatatttctggggaatttggtttggacaactttgattctcagtttactaatgaacct
gtccagctcactccagatgacgatgacattgtgaggaagattgatcagtctgaatttgaa
ggttttgagtatatcaatcctcttttgatgtctgcagaagaatgtgtctga

DBGET integrated database retrieval system