KEGG   Homo sapiens (human): 5584Help
Entry
5584              CDS       T01001                                 

Gene name
PRKCI, DXS1179E, PKCI, nPKC-iota
Definition
protein kinase C, iota (EC:2.7.11.13)
Orthology
K06069  
atypical protein kinase C [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Endocytosis
Hippo signaling pathway
Tight junction
Insulin signaling pathway
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.3
AA seq 596 aa AA seqDB search
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccagagggacagcagcaccatgtcccacacggtcgcaggcggcggcagcggg
gaccattcccaccaggtccgggtgaaagcctactaccgcggggatatcatgataacacat
tttgaaccttccatctcctttgagggcctttgcaatgaggttcgagacatgtgttctttt
gacaacgaacagctcttcaccatgaaatggatagatgaggaaggagacccgtgtacagta
tcatctcagttggagttagaagaagcctttagactttatgagctaaacaaggattctgaa
ctcttgattcatgtgttcccttgtgtaccagaacgtcctgggatgccttgtccaggagaa
gataaatccatctaccgtagaggtgcacgccgctggagaaagctttattgtgccaatggc
cacactttccaagccaagcgtttcaacaggcgtgctcactgtgccatctgcacagaccga
atatggggacttggacgccaaggatataagtgcatcaactgcaaactcttggttcataag
aagtgccataaactcgtcacaattgaatgtgggcggcattctttgccacaggaaccagtg
atgcccatggatcagtcatccatgcattctgaccatgcacagacagtaattccatataat
ccttcaagtcatgagagtttggatcaagttggtgaagaaaaagaggcaatgaacaccagg
gaaagtggcaaagcttcatccagtctaggtcttcaggattttgatttgctccgggtaata
ggaagaggaagttatgccaaagtactgttggttcgattaaaaaaaacagatcgtatttat
gcaatgaaagttgtgaaaaaagagcttgttaatgatgatgaggatattgattgggtacag
acagagaagcatgtgtttgagcaggcatccaatcatcctttccttgttgggctgcattct
tgctttcagacagaaagcagattgttctttgttatagagtatgtaaatggaggagaccta
atgtttcatatgcagcgacaaagaaaacttcctgaagaacatgccagattttactctgca
gaaatcagtctagcattaaattatcttcatgagcgagggataatttatagagatttgaaa
ctggacaatgtattactggactctgaaggccacattaaactcactgactacggcatgtgt
aaggaaggattacggccaggagatacaaccagcactttctgtggtactcctaattacatt
gctcctgaaattttaagaggagaagattatggtttcagtgttgactggtgggctcttgga
gtgctcatgtttgagatgatggcaggaaggtctccatttgatattgttgggagctccgat
aaccctgaccagaacacagaggattatctcttccaagttattttggaaaaacaaattcgc
ataccacgttctctgtctgtaaaagctgcaagtgttctgaagagttttcttaataaggac
cctaaggaacgattgggttgtcatcctcaaacaggatttgctgatattcagggacacccg
ttcttccgaaatgttgattgggatatgatggagcaaaaacaggtggtacctccctttaaa
ccaaatatttctggggaatttggtttggacaactttgattctcagtttactaatgaacct
gtccagctcactccagatgacgatgacattgtgaggaagattgatcagtctgaatttgaa
ggttttgagtatatcaatcctcttttgatgtctgcagaagaatgtgtctga

DBGET integrated database retrieval system