KEGG   Homo sapiens (human): 5584Help
Entry
5584              CDS       T01001                                 

Gene name
PRKCI, DXS1179E, PKCI, nPKC-iota
Definition
(RefSeq) protein kinase C iota
  KO
K06069  
atypical protein kinase C iota type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Endocytosis
Hippo signaling pathway
Tight junction
Platelet activation
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5584 (PRKCI)
   04390 Hippo signaling pathway
    5584 (PRKCI)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5584 (PRKCI)
  Cellular community - eukaryotes
   04530 Tight junction
    5584 (PRKCI)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5584 (PRKCI)
  Endocrine system
   04910 Insulin signaling pathway
    5584 (PRKCI)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5584 (PRKCI)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5584 (PRKCI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P41743(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.2
AA seq 596 aa AA seqDB search
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccagagggacagcagcaccatgtcccacacggtcgcaggcggcggcagcggg
gaccattcccaccaggtccgggtgaaagcctactaccgcggggatatcatgataacacat
tttgaaccttccatctcctttgagggcctttgcaatgaggttcgagacatgtgttctttt
gacaacgaacagctcttcaccatgaaatggatagatgaggaaggagacccgtgtacagta
tcatctcagttggagttagaagaagcctttagactttatgagctaaacaaggattctgaa
ctcttgattcatgtgttcccttgtgtaccagaacgtcctgggatgccttgtccaggagaa
gataaatccatctaccgtagaggtgcacgccgctggagaaagctttattgtgccaatggc
cacactttccaagccaagcgtttcaacaggcgtgctcactgtgccatctgcacagaccga
atatggggacttggacgccaaggatataagtgcatcaactgcaaactcttggttcataag
aagtgccataaactcgtcacaattgaatgtgggcggcattctttgccacaggaaccagtg
atgcccatggatcagtcatccatgcattctgaccatgcacagacagtaattccatataat
ccttcaagtcatgagagtttggatcaagttggtgaagaaaaagaggcaatgaacaccagg
gaaagtggcaaagcttcatccagtctaggtcttcaggattttgatttgctccgggtaata
ggaagaggaagttatgccaaagtactgttggttcgattaaaaaaaacagatcgtatttat
gcaatgaaagttgtgaaaaaagagcttgttaatgatgatgaggatattgattgggtacag
acagagaagcatgtgtttgagcaggcatccaatcatcctttccttgttgggctgcattct
tgctttcagacagaaagcagattgttctttgttatagagtatgtaaatggaggagaccta
atgtttcatatgcagcgacaaagaaaacttcctgaagaacatgccagattttactctgca
gaaatcagtctagcattaaattatcttcatgagcgagggataatttatagagatttgaaa
ctggacaatgtattactggactctgaaggccacattaaactcactgactacggcatgtgt
aaggaaggattacggccaggagatacaaccagcactttctgtggtactcctaattacatt
gctcctgaaattttaagaggagaagattatggtttcagtgttgactggtgggctcttgga
gtgctcatgtttgagatgatggcaggaaggtctccatttgatattgttgggagctccgat
aaccctgaccagaacacagaggattatctcttccaagttattttggaaaaacaaattcgc
ataccacgttctctgtctgtaaaagctgcaagtgttctgaagagttttcttaataaggac
cctaaggaacgattgggttgtcatcctcaaacaggatttgctgatattcagggacacccg
ttcttccgaaatgttgattgggatatgatggagcaaaaacaggtggtacctccctttaaa
ccaaatatttctggggaatttggtttggacaactttgattctcagtttactaatgaacct
gtccagctcactccagatgacgatgacattgtgaggaagattgatcagtctgaatttgaa
ggttttgagtatatcaatcctcttttgatgtctgcagaagaatgtgtctga

DBGET integrated database retrieval system