KEGG   Homo sapiens (human): 5588Help
Entry
5588              CDS       T01001                                 

Gene name
PRKCQ, PRKCT, nPKC-theta
Definition
protein kinase C, theta (EC:2.7.11.13)
Orthology
K18052  
novel protein kinase C theta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Vascular smooth muscle contraction
Tight junction
T cell receptor signaling pathway
Inflammatory mediator regulation of TRP channels
Adipocytokine signaling pathway
Measles
Disease
H00408  
Type I diabetes mellitus
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    5588 (PRKCQ)
 Cellular Processes
  Cell communication
   04530 Tight junction
    5588 (PRKCQ)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    5588 (PRKCQ)
  Endocrine system
   04920 Adipocytokine signaling pathway
    5588 (PRKCQ)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5588 (PRKCQ)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5588 (PRKCQ)
 Human Diseases
  Infectious diseases
   05162 Measles
    5588 (PRKCQ)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5588 (PRKCQ)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5588 (PRKCQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p15
AA seq 643 aa AA seqDB search
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
EPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPELFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSN
FDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatttcttcggattggcttgtccaactttgactgcgggtcctgccagtcttgt
cagggcgaggctgttaacccttactgtgctgtgctcgtcaaagagtatgtcgaatcagag
aacgggcagatgtatatccagaaaaagcctaccatgtacccaccctgggacagcactttt
gatgcccatatcaacaagggaagagtcatgcagatcattgtgaaaggcaaaaacgtggac
ctcatctctgaaaccaccgtggagctctactcgctggctgagaggtgcaggaagaacaac
gggaagacagaaatatggttagagctgaaacctcaaggccgaatgctaatgaatgcaaga
tactttctggaaatgagtgacacaaaggacatgaatgaatttgagacggaaggcttcttt
gctttgcatcagcgccggggtgccatcaagcaggcaaaggtccaccacgtcaagtgccac
gagttcactgccaccttcttcccacagcccacattttgctctgtctgccacgagtttgtc
tggggcctgaacaaacagggctaccagtgccgacaatgcaatgcagcaattcacaagaag
tgtattgataaagttatagcaaagtgcacaggatcagctatcaatagccgagaaaccatg
ttccacaaggagagattcaaaattgacatgccacacagatttaaagtctacaattacaag
agcccgaccttctgtgaacactgtgggaccctgctgtggggactggcacggcaaggactc
aagtgtgatgcatgtggcatgaatgtgcatcatagatgccagacaaaggtggccaacctt
tgtggcataaaccagaagctaatggctgaagcgctggccatgattgagagcactcaacag
gctcgctgcttaagagatactgaacagatcttcagagaaggtccggttgaaattggtctc
ccatgctccatcaaaaatgaagcaaggccgccatgtttaccgacaccgggaaaaagagag
cctcagggcatttcctgggagtctccgttggatgaggtggataaaatgtgccatcttcca
gaacctgaactgaacaaagaaagaccatctctgcagattaaactaaaaattgaggatttt
atcttgcacaaaatgttggggaaaggaagttttggcaaggtcttcctggcagaattcaag
aaaaccaatcaatttttcgcaataaaggccttaaagaaagatgtggtcttgatggacgat
gatgttgagtgcacgatggtagagaagagagttctttccttggcctgggagcatccgttt
ctgacgcacatgttttgtacattccagaccaaggaaaacctcttttttgtgatggagtac
ctcaacggaggggacttaatgtaccacatccaaagctgccacaagttcgacctttccaga
gcgacgttttatgctgctgaaatcattcttggtctgcagttccttcattccaaaggaata
gtctacagggacctgaagctagataacatcctgttagacaaagatggacatatcaagatc
gcggattttggaatgtgcaaggagaacatgttaggagatgccaagacgaataccttctgt
gggacacctgactacatcgccccagagctcttcgtgcgagaacctgagaagaggctgggc
gtgaggggagacatccgccagcaccctttgtttcgggagatcaactgggaggaacttgaa
cggaaggagattgacccaccgttccggccgaaagtgaaatcaccatttgactgcagcaat
ttcgacaaagaattcttaaacgagaagccccggctgtcatttgccgacagagcactgatc
aacagcatggaccagaatatgttcaggaacttttccttcatgaaccccgggatggagcgg
ctgatatcctga

DBGET integrated database retrieval system