KEGG   Homo sapiens (human): 5588Help
Entry
5588              CDS       T01001                                 

Gene name
PRKCQ, PRKCT, nPKC-theta
Definition
protein kinase C, theta (EC:2.7.11.13)
Orthology
K18052  
novel protein kinase C theta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Vascular smooth muscle contraction
Tight junction
T cell receptor signaling pathway
Inflammatory mediator regulation of TRP channels
Adipocytokine signaling pathway
Measles
Disease
H00408  
Type I diabetes mellitus
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p15
AA seq 643 aa AA seqDB search
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
EPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPELFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSN
FDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatttcttcggattggcttgtccaactttgactgcgggtcctgccagtcttgt
cagggcgaggctgttaacccttactgtgctgtgctcgtcaaagagtatgtcgaatcagag
aacgggcagatgtatatccagaaaaagcctaccatgtacccaccctgggacagcactttt
gatgcccatatcaacaagggaagagtcatgcagatcattgtgaaaggcaaaaacgtggac
ctcatctctgaaaccaccgtggagctctactcgctggctgagaggtgcaggaagaacaac
gggaagacagaaatatggttagagctgaaacctcaaggccgaatgctaatgaatgcaaga
tactttctggaaatgagtgacacaaaggacatgaatgaatttgagacggaaggcttcttt
gctttgcatcagcgccggggtgccatcaagcaggcaaaggtccaccacgtcaagtgccac
gagttcactgccaccttcttcccacagcccacattttgctctgtctgccacgagtttgtc
tggggcctgaacaaacagggctaccagtgccgacaatgcaatgcagcaattcacaagaag
tgtattgataaagttatagcaaagtgcacaggatcagctatcaatagccgagaaaccatg
ttccacaaggagagattcaaaattgacatgccacacagatttaaagtctacaattacaag
agcccgaccttctgtgaacactgtgggaccctgctgtggggactggcacggcaaggactc
aagtgtgatgcatgtggcatgaatgtgcatcatagatgccagacaaaggtggccaacctt
tgtggcataaaccagaagctaatggctgaagcgctggccatgattgagagcactcaacag
gctcgctgcttaagagatactgaacagatcttcagagaaggtccggttgaaattggtctc
ccatgctccatcaaaaatgaagcaaggccgccatgtttaccgacaccgggaaaaagagag
cctcagggcatttcctgggagtctccgttggatgaggtggataaaatgtgccatcttcca
gaacctgaactgaacaaagaaagaccatctctgcagattaaactaaaaattgaggatttt
atcttgcacaaaatgttggggaaaggaagttttggcaaggtcttcctggcagaattcaag
aaaaccaatcaatttttcgcaataaaggccttaaagaaagatgtggtcttgatggacgat
gatgttgagtgcacgatggtagagaagagagttctttccttggcctgggagcatccgttt
ctgacgcacatgttttgtacattccagaccaaggaaaacctcttttttgtgatggagtac
ctcaacggaggggacttaatgtaccacatccaaagctgccacaagttcgacctttccaga
gcgacgttttatgctgctgaaatcattcttggtctgcagttccttcattccaaaggaata
gtctacagggacctgaagctagataacatcctgttagacaaagatggacatatcaagatc
gcggattttggaatgtgcaaggagaacatgttaggagatgccaagacgaataccttctgt
gggacacctgactacatcgccccagagctcttcgtgcgagaacctgagaagaggctgggc
gtgaggggagacatccgccagcaccctttgtttcgggagatcaactgggaggaacttgaa
cggaaggagattgacccaccgttccggccgaaagtgaaatcaccatttgactgcagcaat
ttcgacaaagaattcttaaacgagaagccccggctgtcatttgccgacagagcactgatc
aacagcatggaccagaatatgttcaggaacttttccttcatgaaccccgggatggagcgg
ctgatatcctga

DBGET integrated database retrieval system