KEGG   Homo sapiens (human): 5590Help
Entry
5590              CDS       T01001                                 

Gene name
PRKCZ, PKC-ZETA, PKC2
Definition
protein kinase C, zeta (EC:2.7.11.13)
Orthology
K06069  
atypical protein kinase C [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Tight junction
Platelet activation
Insulin signaling pathway
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5590 (PRKCZ)
   04390 Hippo signaling pathway
    5590 (PRKCZ)
   04151 PI3K-Akt signaling pathway
    5590 (PRKCZ)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5590 (PRKCZ)
  Cellular commiunity
   04530 Tight junction
    5590 (PRKCZ)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5590 (PRKCZ)
   04062 Chemokine signaling pathway
    5590 (PRKCZ)
  Endocrine system
   04910 Insulin signaling pathway
    5590 (PRKCZ)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5590 (PRKCZ)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5590 (PRKCZ)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5590 (PRKCZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.33-p36.2
AA seq 409 aa AA seqDB search
MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKI
SQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHV
FEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIA
LNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEIL
RGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSV
KASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDY
GLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggattctgtcatgccttcccaagagcctccagtagacgacaagaacgaggacgccgac
cttccttccgaggagacagatggaattgcttacatttcctcatcccggaagcatgacagc
attaaagacgactcggaggaccttaagccagttatcgatgggatggatggaatcaaaatc
tctcaggggcttgggctgcaggactttgacctaatcagagtcatcgggcgcgggagctac
gccaaggttctcctggtgcggttgaagaagaatgaccaaatttacgccatgaaagtggtg
aagaaagagctggtgcatgatgacgaggatattgactgggtacagacagagaagcacgtg
tttgagcaggcatccagcaaccccttcctggtcggattacactcctgcttccagacgaca
agtcggttgttcctggtcattgagtacgtcaacggcggggacctgatgttccacatgcag
aggcagaggaagctccctgaggagcacgccaggttctacgcggccgagatctgcatcgcc
ctcaacttcctgcacgagagggggatcatctacagggacctgaagctggacaacgtcctc
ctggatgcggacgggcacatcaagctcacagactacggcatgtgcaaggaaggcctgggc
cctggtgacacaacgagcactttctgcggaaccccgaattacatcgcccccgaaatcctg
cggggagaggagtacgggttcagcgtggactggtgggcgctgggagtcctcatgtttgag
atgatggccgggcgctccccgttcgacatcatcaccgacaacccggacatgaacacagag
gactaccttttccaagtgatcctggagaagcccatccggatcccccggttcctgtccgtc
aaagcctcccatgttttaaaaggatttttaaataaggaccccaaagagaggctcggctgc
cggccacagactggattttctgacatcaagtcccacgcgttcttccgcagcatagactgg
gacttgctggagaagaagcaggcgctccctccattccagccacagatcacagacgactac
ggtctggacaactttgacacacagttcaccagcgagcccgtgcagctgaccccagacgat
gaggatgccataaagaggatcgaccagtcagagttcgaaggctttgagtatatcaaccca
ttattgctgtccaccgaggagtcggtgtga

DBGET integrated database retrieval system