KEGG   Homo sapiens (human): 5590Help
Entry
5590              CDS       T01001                                 

Gene name
PRKCZ, PKC-ZETA, PKC2
Definition
protein kinase C, zeta (EC:2.7.11.13)
Orthology
K06069  
atypical protein kinase C [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Tight junction
Insulin signaling pathway
Type II diabetes mellitus
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.33-p36.2
AA seq 409 aa AA seqDB search
MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKI
SQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHV
FEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIA
LNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEIL
RGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSV
KASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDY
GLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggattctgtcatgccttcccaagagcctccagtagacgacaagaacgaggacgccgac
cttccttccgaggagacagatggaattgcttacatttcctcatcccggaagcatgacagc
attaaagacgactcggaggaccttaagccagttatcgatgggatggatggaatcaaaatc
tctcaggggcttgggctgcaggactttgacctaatcagagtcatcgggcgcgggagctac
gccaaggttctcctggtgcggttgaagaagaatgaccaaatttacgccatgaaagtggtg
aagaaagagctggtgcatgatgacgaggatattgactgggtacagacagagaagcacgtg
tttgagcaggcatccagcaaccccttcctggtcggattacactcctgcttccagacgaca
agtcggttgttcctggtcattgagtacgtcaacggcggggacctgatgttccacatgcag
aggcagaggaagctccctgaggagcacgccaggttctacgcggccgagatctgcatcgcc
ctcaacttcctgcacgagagggggatcatctacagggacctgaagctggacaacgtcctc
ctggatgcggacgggcacatcaagctcacagactacggcatgtgcaaggaaggcctgggc
cctggtgacacaacgagcactttctgcggaaccccgaattacatcgcccccgaaatcctg
cggggagaggagtacgggttcagcgtggactggtgggcgctgggagtcctcatgtttgag
atgatggccgggcgctccccgttcgacatcatcaccgacaacccggacatgaacacagag
gactaccttttccaagtgatcctggagaagcccatccggatcccccggttcctgtccgtc
aaagcctcccatgttttaaaaggatttttaaataaggaccccaaagagaggctcggctgc
cggccacagactggattttctgacatcaagtcccacgcgttcttccgcagcatagactgg
gacttgctggagaagaagcaggcgctccctccattccagccacagatcacagacgactac
ggtctggacaactttgacacacagttcaccagcgagcccgtgcagctgaccccagacgat
gaggatgccataaagaggatcgaccagtcagagttcgaaggctttgagtatatcaaccca
ttattgctgtccaccgaggagtcggtgtga

DBGET integrated database retrieval system