KEGG   Homo sapiens (human): 5591Help
Entry
5591              CDS       T01001                                 

Gene name
PRKDC, DNA-PKcs, DNAPK, DNPK1, HYRC, HYRC1, XRCC7, p350
Definition
protein kinase, DNA-activated, catalytic polypeptide (EC:2.7.11.1)
Orthology
K06642  
DNA-dependent protein kinase catalytic subunit [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Non-homologous end-joining
Cell cycle
Module
DNA-PK complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    5591 (PRKDC)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5591 (PRKDC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5591 (PRKDC)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   5591 (PRKDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
8q11
AA seq 4097 aa AA seqDB search
MAGSGAGVRCSLLRLQETLSAADRCGAALAGHQLIRGLGQECVLSSSPAVLALQTSLVFS
RDFGLLVFVRKSLNSIEFRECREEILKFLCIFLEKMGQKIAPYSVEIKNTCTSVYTKDRA
AKCKIPALDLLIKLLQTFRSSRLMDEFKIGELFSKFYGELALKKKIPDTVLEKVYELLGL
LGEVHPSEMINNAENLFRAFLGELKTQMTSAVREPKLPVLAGCLKGLSSLLCNFTKSMEE
DPQTSREIFNFVLKAIRPQIDLKRYAVPSAGLRLFALHASQFSTCLLDNYVSLFEVLLKW
CAHTNVELKKAALSALESFLKQVSNMVAKNAEMHKNKLQYFMEQFYGIIRNVDSNNKELS
IAIRGYGLFAGPCKVINAKDVDFMYVELIQRCKQMFLTQTDTGDDRVYQMPSFLQSVASV
LLYLDTVPEVYTPVLEHLVVMQIDSFPQYSPKMQLVCCRAIVKVFLALAAKGPVLRNCIS
TVVHQGLIRICSKPVVLPKGPESESEDHRASGEVRTGKWKVPTYKDYVDLFRHLLSSDQM
MDSILADEAFFSVNSSSESLNHLLYDEFVKSVLKIVEKLDLTLEIQTVGEQENGDEAPGV
WMIPTSDPAANLHPAKPKDFSAFINLVEFCREILPEKQAEFFEPWVYSFSYELILQSTRL
PLISGFYKLLSITVRNAKKIKYFEGVSPKSLKHSPEDPEKYSCFALFVKFGKEVAVKMKQ
YKDELLASCLTFLLSLPHNIIELDVRAYVPALQMAFKLGLSYTPLAEVGLNALEEWSIYI
DRHVMQPYYKDILPCLDGYLKTSALSDETKNNWEVSALSRAAQKGFNKVVLKHLKKTKNL
SSNEAISLEEIRIRVVQMLGSLGGQINKNLLTVTSSDEMMKSYVAWDREKRLSFAVPFRE
MKPVIFLDVFLPRVTELALTASDRQTKVAACELLHSMVMFMLGKATQMPEGGQGAPPMYQ
LYKRTFPVLLRLACDVDQVTRQLYEPLVMQLIHWFTNNKKFESQDTVALLEAILDGIVDP
VDSTLRDFCGRCIREFLKWSIKQITPQQQEKSPVNTKSLFKRLYSLALHPNAFKRLGASL
AFNNIYREFREEESLVEQFVFEALVIYMESLALAHADEKSLGTIQQCCDAIDHLCRIIEK
KHVSLNKAKKRRLPRGFPPSASLCLLDLVKWLLAHCGRPQTECRHKSIELFYKFVPLLPG
NRSPNLWLKDVLKEEGVSFLINTFEGGGCGQPSGILAQPTLLYLRGPFSLQATLCWLDLL
LAALECYNTFIGERTVGALQVLGTEAQSSLLKAVAFFLESIAMHDIIAAEKCFGTGAAGN
RTSPQEGERYNYSKCTVVVRIMEFTTTLLNTSPEGWKLLKKDLCNTHLMRVLVQTLCEPA
SIGFNIGDVQVMAHLPDVCVNLMKALKMSPYKDILETHLREKITAQSIEELCAVNLYGPD
AQVDRSRLAAVVSACKQLHRAGLLHNILPSQSTDLHHSVGTELLSLVYKGIAPGDERQCL
PSLDLSCKQLASGLLELAFAFGGLCERLVSLLLNPAVLSTASLGSSQGSVIHFSHGEYFY
SLFSETINTELLKNLDLAVLELMQSSVDNTKMVSAVLNGMLDQSFRERANQKHQGLKLAT
TILQHWKKCDSWWAKDSPLETKMAVLALLAKILQIDSSVSFNTSHGSFPEVFTTYISLLA
DTKLDLHLKGQAVTLLPFFTSLTGGSLEELRRVLEQLIVAHFPMQSREFPPGTPRFNNYV
DCMKKFLDALELSQSPMLLELMTEVLCREQQHVMEELFQSSFRRIARRGSCVTQVGLLES
VYEMFRKDDPRLSFTRQSFVDRSLLTLLWHCSLDALREFFSTIVVDAIDVLKSRFTKLNE
STFDTQITKKMGYYKILDVMYSRLPKDDVHAKESKINQVFHGSCITEGNELTKTLIKLCY
DAFTENMAGENQLLERRRLYHCAAYNCAISVICCVFNELKFYQGFLFSEKPEKNLLIFEN
LIDLKRRYNFPVEVEVPMERKKKYIEIRKEAREAANGDSDGPSYMSSLSYLADSTLSEEM
SQFDFSTGVQSYSYSSQDPRPATGRFRRREQRDPTVHDDVLELEMDELNRHECMAPLTAL
VKHMHRSLGPPQGEEDSVPRDLPSWMKFLHGKLGNPIVPLNIRLFLAKLVINTEEVFRPY
AKHWLSPLLQLAASENNGGEGIHYMVVEIVATILSWTGLATPTGVPKDEVLANRLLNFLM
KHVFHPKRAVFRHNLEIIKTLVECWKDCLSIPYRLIFEKFSGKDPNSKDNSVGIQLLGIV
MANDLPPYDPQCGIQSSEYFQALVNNMSFVRYKEVYAAAAEVLGLILRYVMERKNILEES
LCELVAKQLKQHQNTMEDKFIVCLNKVTKSFPPLADRFMNAVFFLLPKFHGVLKTLCLEV
VLCRVEGMTELYFQLKSKDFVQVMRHRDDERQKVCLDIIYKMMPKLKPVELRELLNPVVE
FVSHPSTTCREQMYNILMWIHDNYRDPESETDNDSQEIFKLAKDVLIQGLIDENPGLQLI
IRNFWSHETRLPSNTLDRLLALNSLYSPKIEVHFLSLATNFLLEMTSMSPDYPNPMFEHP
LSECEFQEYTIDSDWRFRSTVLTPMFVETQASQGTLQTRTQEGSLSARWPVAGQIRATQQ
QHDFTLTQTADGRSSFDWLTGSSTDPLVDHTSPSSDSLLFAHKRSERLQRAPLKSVGPDF
GKKRLGLPGDEVDNKVKGAAGRTDLLRLRRRFMRDQEKLSLMYARKGVAEQKREKEIKSE
LKMKQDAQVVLYRSYRHGDLPDIQIKHSSLITPLQAVAQRDPIIAKQLFSSLFSGILKEM
DKFKTLSEKNNITQKLLQDFNRFLNTTFSFFPPFVSCIQDISCQHAALLSLDPAAVSAGC
LASLQQPVGIRLLEEALLRLLPAELPAKRVRGKARLPPDVLRWVELAKLYRSIGEYDVLR
GIFTSEIGTKQITQSALLAEARSDYSEAAKQYDEALNKQDWVDGEPTEAEKDFWELASLD
CYNHLAEWKSLEYCSTASIDSENPPDLNKIWSEPFYQETYLPYMIRSKLKLLLQGEADQS
LLTFIDKAMHGELQKAILELHYSQELSLLYLLQDDVDRAKYYIQNGIQSFMQNYSSIDVL
LHQSRLTKLQSVQALTEIQEFISFISKQGNLSSQVPLKRLLNTWTNRYPDAKMDPMNIWD
DIITNRCFFLSKIEEKLTPLPEDNSMNVDQDGDPSDRMEVQEQEEDISSLIRSCKFSMKM
KMIDSARKQNNFSLAMKLLKELHKESKTRDDWLVSWVQSYCRLSHCRSRSQGCSEQVLTV
LKTVSLLDENNVSSYLSKNILAFRDQNILLGTTYRIIANALSSEPACLAEIEEDKARRIL
ELSGSSSEDSEKVIAGLYQRAFQHLSEAVQAAEEEAQPPSWSCGPAAGVIDAYMTLADFC
DQQLRKEEENASVIDSAELQAYPALVVEKMLKALKLNSNEARLKFPRLLQIIERYPEETL
SLMTKEISSVPCWQFISWISHMVALLDKDQAVAVQHSVEEITDNYPQAIVYPFIISSESY
SFKDTSTGHKNKEFVARIKSKLDQGGVIQDFINALDQLSNPELLFKDWSNDVRAELAKTP
VNKKNIEKMYERMYAALGDPKAPGLGAFRRKFIQTFGKEFDKHFGKGGSKLLRMKLSDFN
DITNMLLLKMNKDSKPPGNLKECSPWMSDFKVEFLRNELEIPGQYDGRGKPLPEYHVRIA
GFDERVTVMASLRRPKRIIIRGHDEREHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSA
CSQRALQLRTYSVVPMTSSDPRAPPCEYKDWLTKMSGKHDVGAYMLMYKGANRTETVTSF
RKRESKVPADLLKRAFVRMSTSPEAFLALRSHFASSHALICISHWILGIGDRHLNNFMVA
METGGVIGIDFGHAFGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAF
RSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKL
AGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQA
TDPNILGRTWEGWEPWM
NT seq 12294 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctccggagccggtgtgcgttgctccctgctgcggctgcaggagaccttgtcc
gctgcggaccgctgcggtgctgccctggccggtcatcaactgatccgcggcctggggcag
gaatgcgtcctgagcagcagccccgcggtgctggcattacagacatctttagttttttcc
agagatttcggtttgcttgtatttgtccggaagtcactcaacagtattgaatttcgtgaa
tgtagagaagaaatcctaaagtttttatgtattttcttagaaaaaatgggccagaagatc
gcaccttactctgttgaaattaagaacacttgtaccagtgtttatacaaaagatagagct
gctaaatgtaaaattccagccctggaccttcttattaagttacttcagacttttagaagt
tctagactcatggatgaatttaaaattggagaattatttagtaaattctatggagaactt
gcattgaaaaaaaaaataccagatacagttttagaaaaagtatatgagctcctaggatta
ttgggtgaagttcatcctagtgagatgataaataatgcagaaaacctgttccgcgctttt
ctgggtgaacttaagacccagatgacatcagcagtaagagagcccaaactacctgttctg
gcaggatgtctgaaggggttgtcctcacttctgtgcaacttcactaagtccatggaagaa
gatccccagacttcaagggagatttttaattttgtactaaaggcaattcgtcctcagatt
gatctgaagagatatgctgtgccctcagctggcttgcgcctatttgccctgcatgcatct
cagtttagcacctgccttctggacaactacgtgtctctatttgaagtcttgttaaagtgg
tgtgcccacacaaatgtagaattgaaaaaagctgcactttcagccctggaatcctttctg
aaacaggtttctaatatggtggcgaaaaatgcagaaatgcataaaaataaactgcagtac
tttatggagcagttttatggaatcatcagaaatgtggattcgaacaacaaggagttatct
attgctatccgtggatatggactttttgcaggaccgtgcaaggttataaacgcaaaagat
gttgacttcatgtacgttgagctcattcagcgctgcaagcagatgttcctcacccagaca
gacactggtgacgaccgtgtttatcagatgccaagcttcctccagtctgttgcaagcgtc
ttgctgtaccttgacacagttcctgaggtgtatactccagttctggagcacctcgtggtg
atgcagatagacagtttcccacagtacagtccaaaaatgcagctggtgtgttgcagagcc
atagtgaaggtgttcctagctttggcagcaaaagggccagttctcaggaattgcattagt
actgtggtgcatcagggtttaatcagaatatgttctaaaccagtggtccttccaaagggc
cctgagtctgaatctgaagaccaccgtgcttcaggggaagtcagaactggcaaatggaag
gtgcccacatacaaagactacgtggatctcttcagacatctcctgagctctgaccagatg
atggattctattttagcagatgaagcatttttctctgtgaattcctccagtgaaagtctg
aatcatttactttatgatgaatttgtaaaatccgttttgaagattgttgagaaattggat
cttacacttgaaatacagactgttggggaacaagagaatggagatgaggcgcctggtgtt
tggatgatcccaacttcagatccagcggctaacttgcatccagctaaacctaaagatttt
tcggctttcattaacctggtggaattttgcagagagattctccctgagaaacaagcagaa
ttttttgaaccatgggtgtactcattttcatatgaattaattttgcaatctacaaggttg
cccctcatcagtggtttctacaaattgctttctattacagtaagaaatgccaagaaaata
aaatatttcgagggagttagtccaaagagtctgaaacactctcctgaagacccagaaaag
tattcttgctttgctttatttgtgaaatttggcaaagaggtggcagttaaaatgaagcag
tacaaagatgaacttttggcctcttgtttgacctttcttctgtccttgccacacaacatc
attgaactcgatgttagagcctacgttcctgcactgcagatggctttcaaactgggcctg
agctatacccccttggcagaagtaggcctgaatgctctagaagaatggtcaatttatatt
gacagacatgtaatgcagccttattacaaagacattctcccctgcctggatggatacctg
aagacttcagccttgtcagatgagaccaagaataactgggaagtgtcagctctttctcgg
gctgcccagaaaggatttaataaagtggtgttaaagcatctgaagaagacaaagaacctt
tcatcaaacgaagcaatatccttagaagaaataagaattagagtagtacaaatgcttgga
tctctaggaggacaaataaacaaaaatcttctgacagtcacgtcctcagatgagatgatg
aagagctatgtggcctgggacagagagaagcggctgagctttgcagtgccctttagagag
atgaaacctgtcattttcctggatgtgttcctgcctcgagtcacagaattagcgctcaca
gccagtgacagacaaactaaagttgcagcctgtgaacttttacatagcatggttatgttt
atgttgggcaaagccacgcagatgccagaagggggacagggagccccacccatgtaccag
ctctataagcggacgtttcctgtgctgcttcgacttgcgtgtgatgttgatcaggtgaca
aggcaactgtatgagccactagttatgcagctgattcactggttcactaacaacaagaaa
tttgaaagtcaggatactgttgccttactagaagctatattggatggaattgtggaccct
gttgacagtactttaagagatttttgtggtcggtgtattcgagaattccttaaatggtcc
attaagcaaataacaccacagcagcaggagaagagtccagtaaacaccaaatcgcttttc
aagcgactttatagccttgcgcttcaccccaatgctttcaagaggctgggagcatcactt
gcctttaataatatctacagggaattcagggaagaagagtctctggtggaacagtttgtg
tttgaagccttggtgatatacatggagagtctggccttagcacatgcagatgagaagtcc
ttaggtacaattcaacagtgttgtgatgccattgatcacctatgccgcatcattgaaaag
aagcatgtttctttaaataaagcaaagaaacgacgtttgccgcgaggatttccaccttcc
gcatcattgtgtttattggatctggtcaagtggcttttagctcattgtgggaggccccag
acagaatgtcgacacaaatccattgaactcttttataaattcgttcctttattgccaggc
aacagatcccctaatttgtggctgaaagatgttctcaaggaagaaggtgtctcttttctc
atcaacacctttgaggggggtggctgtggccagccctcgggcatcctggcccagcccacc
ctcttgtaccttcgggggccattcagcctgcaggccacgctatgctggctggacctgctc
ctggccgcgttggagtgctacaacacgttcattggcgagagaactgtaggagcgctccag
gtcctaggtactgaagcccagtcttcacttttgaaagcagtggctttcttcttagaaagc
attgccatgcatgacattatagcagcagaaaagtgctttggcactggggcagcaggtaac
agaacaagcccacaagagggagaaaggtacaactacagcaaatgcaccgttgtggtccgg
attatggagtttaccacgactctgctaaacacctccccggaaggatggaagctcctgaag
aaggacttgtgtaatacacacctgatgagagtcctggtgcagacgctgtgtgagcccgca
agcataggtttcaacatcggagacgtccaggttatggctcatcttcctgatgtttgtgtg
aatctgatgaaagctctaaagatgtccccatacaaagatatcctagagacccatctgaga
gagaaaataacagcacagagcattgaggagctttgtgccgtcaacttgtatggccctgac
gcgcaagtggacaggagcaggctggctgctgttgtgtctgcctgtaaacagcttcacaga
gctgggcttctgcataatatattaccgtctcagtccacagatttgcatcattctgttggc
acagaacttctttccctggtttataaaggcattgcccctggagatgagagacagtgtctg
ccttctctagacctcagttgtaagcagctggccagcggacttctggagttagcctttgct
tttggaggactgtgtgagcgccttgtgagtcttctcctgaacccagcggtgctgtccacg
gcgtccttgggcagctcacagggcagcgtcatccacttctcccatggggagtatttctat
agcttgttctcagaaacgatcaacacggaattattgaaaaatctggatcttgctgtattg
gagctcatgcagtcttcagtggataataccaaaatggtgagtgccgttttgaacggcatg
ttagaccagagcttcagggagcgagcaaaccagaaacaccaaggactgaaacttgcgact
acaattctgcaacactggaagaagtgtgattcatggtgggccaaagattcccctctcgaa
actaaaatggcagtgctggccttactggcaaaaattttacagattgattcatctgtatct
tttaatacaagtcatggttcattccctgaagtctttacaacatatattagtctacttgct
gacacaaagctggatctacatttaaagggccaagctgtcactcttcttccattcttcacc
agcctcactggaggcagtctggaggaacttagacgtgttctggagcagctcatcgttgct
cacttccccatgcagtccagggaatttcctccaggaactccgcggttcaataattatgtg
gactgcatgaaaaagtttctagatgcattggaattatctcaaagccctatgttgttggaa
ttgatgacagaagttctttgtcgggaacagcagcatgtcatggaagaattatttcaatcc
agtttcaggaggattgccagaaggggttcatgtgtcacacaagtaggccttctggaaagc
gtgtatgaaatgttcaggaaggatgacccccgcctaagtttcacacgccagtcctttgtg
gaccgctccctcctcactctgctgtggcactgtagcctggatgctttgagagaattcttc
agcacaattgtggtggatgccattgatgtgttgaagtccaggtttacaaagctaaatgaa
tctacctttgatactcaaatcaccaagaagatgggctactataagattctagacgtgatg
tattctcgccttcccaaagatgatgttcatgctaaggaatcaaaaattaatcaagttttc
catggctcgtgtattacagaaggaaatgaacttacaaagacattgattaaattgtgctac
gatgcatttacagagaacatggcaggagagaatcagctgctggagaggagaagactttac
cattgtgcagcatacaactgcgccatatctgtcatctgctgtgtcttcaatgagttaaaa
ttttaccaaggttttctgtttagtgaaaaaccagaaaagaacttgcttatttttgaaaat
ctgatcgacctgaagcgccgctataattttcctgtagaagttgaggttcctatggaaaga
aagaaaaagtacattgaaattaggaaagaagccagagaagcagcaaatggggattcagat
ggtccttcctatatgtcttccctgtcatatttggcagacagtaccctgagtgaggaaatg
agtcaatttgatttctcaaccggagttcagagctattcatacagctcccaagaccctaga
cctgccactggtcgttttcggagacgggagcagcgggaccccacggtgcatgatgatgtg
ctggagctggagatggacgagctcaatcggcatgagtgcatggcgcccctgacggccctg
gtcaagcacatgcacagaagcctgggcccgcctcaaggagaagaggattcagtgccaaga
gatcttccttcttggatgaaattcctccatggcaaactgggaaatccaatagtaccatta
aatatccgtctcttcttagccaagcttgttattaatacagaagaggtctttcgcccttac
gcgaagcactggcttagccccttgctgcagctggctgcttctgaaaacaatggaggagaa
ggaattcactacatggtggttgagatagtggccactattctttcatggacaggcttggcc
actccaacaggggtccctaaagatgaagtgttagcaaatcgattgcttaatttcctaatg
aaacatgtctttcatccaaaaagagctgtgtttagacacaaccttgaaattataaagacc
cttgtcgagtgctggaaggattgtttatccatcccttataggttaatatttgaaaagttt
tccggtaaagatcctaattctaaagacaactcagtagggattcaattgctaggcatcgtg
atggccaatgacctgcctccctatgacccacagtgtggcatccagagtagcgaatacttc
caggctttggtgaataatatgtcctttgtaagatataaagaagtgtatgccgctgcagca
gaagttctaggacttatacttcgatatgttatggagagaaaaaacatactggaggagtct
ctgtgtgaactggttgcgaaacaattgaagcaacatcagaatactatggaggacaagttt
attgtgtgcttgaacaaagtgaccaagagcttccctcctcttgcagacaggttcatgaat
gctgtgttctttctgctgccaaaatttcatggagtgttgaaaacactctgtctggaggtg
gtactttgtcgtgtggagggaatgacagagctgtacttccagttaaagagcaaggacttc
gttcaagtcatgagacatagagatgatgaaagacaaaaagtatgtttggacataatttat
aagatgatgccaaagttaaaaccagtagaactccgagaacttctgaaccccgttgtggaa
ttcgtttcccatccttctacaacatgtagggaacaaatgtataatattctcatgtggatt
catgataattacagagatccagaaagtgagacagataatgactcccaggaaatatttaag
ttggcaaaagatgtgctgattcaaggattgatcgatgagaaccctggacttcaattaatt
attcgaaatttctggagccatgaaactaggttaccttcaaataccttggaccggttgctg
gcactaaattccttatattctcctaagatagaagtgcactttttaagtttagcaacaaat
tttctgctcgaaatgaccagcatgagcccagattatccaaaccccatgttcgagcatcct
ctgtcagaatgcgaatttcaggaatataccattgattctgattggcgtttccgaagtact
gttctcactccgatgtttgtggagacccaggcctcccagggcactctccagacccgtacc
caggaagggtccctctcagctcgctggccagtggcagggcagataagggccacccagcag
cagcatgacttcacactgacacagactgcagatggaagaagctcatttgattggctgacc
gggagcagcactgacccgctggtcgaccacaccagtccctcatctgactccttgctgttt
gcccacaagaggagtgaaaggttacagagagcacccttgaagtcagtggggcctgatttt
gggaaaaaaaggctgggccttccaggggacgaggtggataacaaagtgaaaggtgcggcc
ggccggacggacctactacgactgcgcagacggtttatgagggaccaggagaagctcagt
ttgatgtatgccagaaaaggcgttgctgagcaaaaacgagagaaggaaatcaagagtgag
ttaaaaatgaagcaggatgcccaggtcgttctgtacagaagctaccggcacggagacctt
cctgacattcagatcaagcacagcagcctcatcaccccgttacaggccgtggcccagagg
gacccaataattgcaaaacagctctttagcagcttgttttctggaattttgaaagagatg
gataaatttaagacactgtctgaaaaaaacaacatcactcaaaagttgcttcaagacttc
aatcgttttcttaataccaccttctctttctttccaccctttgtctcttgtattcaggac
attagctgtcagcacgcagccctgctgagcctcgacccagcggctgttagcgctggttgc
ctggccagcctacagcagcccgtgggcatccgcctgctagaggaggctctgctccgcctg
ctgcctgctgagctgcctgccaagcgagtccgtgggaaggcccgcctccctcctgatgtc
ctcagatgggtggagcttgctaagctgtatagatcaattggagaatacgacgtcctccgt
gggatttttaccagtgagataggaacaaagcaaatcactcagagtgcattattagcagaa
gccagaagtgattattctgaagctgctaagcagtatgatgaggctctcaataaacaagac
tgggtagatggtgagcccacagaagccgagaaggatttttgggaacttgcatcccttgac
tgttacaaccaccttgctgagtggaaatcacttgaatactgttctacagccagtatagac
agtgagaaccccccagacctaaataaaatctggagtgaaccattttatcaggaaacatat
ctaccttacatgatccgcagcaagctgaagctgctgctccagggagaggctgaccagtcc
ctgctgacatttattgacaaagctatgcacggggagctccagaaggcgattctagagctt
cattacagtcaagagctgagtctgctttacctcctgcaagatgatgttgacagagccaaa
tattacattcaaaatggcattcagagttttatgcagaattattctagtattgatgtcctc
ttacaccaaagtagactcaccaaattgcagtctgtacaggctttaacagaaattcaggag
ttcatcagctttataagcaaacaaggcaatttatcatctcaagttccccttaagagactt
ctgaacacctggacaaacagatatccagatgctaaaatggacccaatgaacatctgggat
gacatcatcacaaatcgatgtttctttctcagcaaaatagaggagaagcttacccctctt
ccagaagataatagtatgaatgtggatcaagatggagaccccagtgacaggatggaagtg
caagagcaggaagaagatatcagctccctgatcaggagttgcaagttttccatgaaaatg
aagatgatagacagtgcccggaagcagaacaatttctcacttgctatgaaactactgaag
gagctgcataaagagtcaaaaaccagagacgattggctggtgagctgggtgcagagctac
tgccgcctgagccactgccggagccggtcccagggctgctctgagcaggtgctcactgtg
ctgaaaacagtctctttgttggatgagaacaacgtgtcaagctacttaagcaaaaatatt
ctggctttccgtgaccagaacattctcttgggtacaacttacaggatcatagcgaatgct
ctcagcagtgagccagcctgccttgctgaaatcgaggaggacaaggctagaagaatctta
gagctttctggatccagttcagaggattcagagaaggtgatcgcgggtctgtaccagaga
gcattccagcacctctctgaggctgtgcaggcggctgaggaggaggcccagcctccctcc
tggagctgtgggcctgcagctggggtgattgatgcttacatgacgctggcagatttctgt
gaccaacagctgcgcaaggaggaagagaatgcatcagttattgattctgcagaactgcag
gcgtatccagcacttgtggtggagaaaatgttgaaagctttaaaattaaattccaatgaa
gccagattgaagtttcctagattacttcagattatagaacggtatccagaggagactttg
agcctcatgacaaaagagatctcttccgttccctgctggcagttcatcagctggatcagc
cacatggtggccttactggacaaagaccaagccgttgctgttcagcactctgtggaagaa
atcactgataactacccgcaggctattgtttatcccttcatcataagcagcgaaagctat
tccttcaaggatacttctactggtcataagaataaggagtttgtggcaaggattaaaagt
aagttggatcaaggaggagtgattcaagattttattaatgccttagatcagctctctaat
cctgaactgctctttaaggattggagcaatgatgtaagagctgaactagcaaaaacccct
gtaaataaaaaaaacattgaaaaaatgtatgaaagaatgtatgcagccttgggtgaccca
aaggctccaggcctgggggcctttagaaggaagtttattcagacttttggaaaagaattt
gataaacattttgggaaaggaggttctaaactactgagaatgaagctcagtgacttcaac
gacattaccaacatgctacttttaaaaatgaacaaagactcaaagccccctgggaatctg
aaagaatgttcaccctggatgagcgacttcaaagtggagttcctgagaaatgagctggag
attcccggtcagtatgacggtaggggaaagccattgccagagtaccacgtgcgaatcgcc
gggtttgatgagcgggtgacagtcatggcgtctctgcgaaggcccaagcgcatcatcatc
cgtggccatgacgagagggaacaccctttcctggtgaagggtggcgaggacctgcggcag
gaccagcgcgtggagcagctcttccaggtcatgaatgggatcctggcccaagactccgcc
tgcagccagagggccctgcagctgaggacctatagcgttgtgcccatgacctccagtgat
cccagggcaccgccgtgtgaatataaagattggctgacaaaaatgtcaggaaaacatgat
gttggagcttacatgctaatgtataagggcgctaatcgtactgaaacagtcacgtctttt
agaaaacgagaaagtaaagtgcctgctgatctcttaaagcgggccttcgtgaggatgagt
acaagccctgaggctttcctggcgctccgctcccacttcgccagctctcacgctctgata
tgcatcagccactggatcctcgggattggagacagacatctgaacaactttatggtggcc
atggagactggcggcgtgatcgggatcgactttgggcatgcgtttggatccgctacacag
tttctgccagtccctgagttgatgccttttcggctaactcgccagtttatcaatctgatg
ttaccaatgaaagaaacgggccttatgtacagcatcatggtacacgcactccgggccttc
cgctcagaccctggcctgctcaccaacaccatggatgtgtttgtcaaggagccctccttt
gattggaaaaattttgaacagaaaatgctgaaaaaaggagggtcatggattcaagaaata
aatgttgctgaaaaaaattggtacccccgacagaaaatatgttacgctaagagaaagtta
gcaggtgccaatccagcagtcattacttgtgatgagctactcctgggtcatgagaaggcc
cctgccttcagagactatgtggctgtggcacgaggaagcaaagatcacaacattcgtgcc
caagaaccagagagtgggctttcagaagagactcaagtgaagtgcctgatggaccaggca
acagaccccaacatccttggcagaacctgggaaggatgggagccctggatgtga

DBGET integrated database retrieval system