KEGG   Homo sapiens (human): 5592Help
Entry
5592              CDS       T01001                                 

Gene name
PRKG1, 1, AAT8, PKG, PRKG1B, PRKGR1B, cGK, cGK_1, cGK1, cGKI, cGKI-BETA, cGKI-alpha
Definition
protein kinase, cGMP-dependent, type I (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    5592 (PRKG1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    5592 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5592 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5592 (PRKG1)
  Digestive system
   04970 Salivary secretion
    5592 (PRKG1)
  Nervous system
   04730 Long-term depression
    5592 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    5592 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    5592 (PRKG1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     5592 (PRKG1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   5592 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11.2
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctagaggaagactttgccaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaattcaggagctgaagaggaaactc
cacaaatgccagtcggtgctcccagtgccctcgacccacatcggcccccggaccacccgg
gcgcagggcatctcggccgagccgcagacgtacaggtccttccacgacctccgacaggca
ttccggaagttcaccaagtccgaaaggtccaaggatcttataaaggaagctatccttgac
aatgactttatgaagaacttggagctgtcgcagatccaggagattgtggattgtatgtac
ccggtggagtatggcaaggacagttgcatcatcaaagaaggagacgtggggtcactggtg
tatgtcatggaagatggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatg
ggtccaggaaaagtgtttggggaattggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtaaaactctgggccattgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagcgttcca
acattccagagccttcctgaagagatcctcagcaagcttgctgatgtccttgaagagacc
cactatgaaaatggagaatatattatcaggcaaggtgcaagaggggacaccttctttatc
atcagcaaaggaacggtaaatgtcactcgtgaagactcaccgagtgaagacccagtcttt
cttagaactttaggaaaaggagactggtttggagagaaagccttgcagggggaagatgtg
agaacagcaaacgtaattgctgcagaagctgtaacctgccttgtgattgacagagactct
tttaaacatttgattggagggctggatgatgtttctaataaagcatatgaagatgcagaa
gctaaagcaaaatatgaagctgaagcggctttcttcgccaacctgaagctgtctgatttc
aacatcattgatacccttggagttggaggtttcggacgagtagaactggtccagttgaaa
agtgaagaatccaaaacgtttgcaatgaagattctcaagaaacgtcacattgtggacaca
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttc
atagtgagactgtacagaacatttaaggacagcaaatatttgtatatgttgatggaagct
tgtctaggtggagagctctggaccattctcagggatagaggttcgtttgaagattctaca
accagattttacacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagagtatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgac
tactggtcactgggaatcctaatgtatgaactcctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctataacatcatattgagggggattgacatgatagaatttcca
aagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatca
gaaagattagggaatttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgag
ggctttaactgggaaggcttaagaaaaggtaccttgacacctcctataataccaagtgtt
gcatcacccacagacacaagtaattttgacagtttccctgaggacaacgatgaaccacca
cctgatgacaactcaggatgggatatagacttctaa

DBGET integrated database retrieval system