KEGG   Homo sapiens (human): 55967Help
Entry
55967             CDS       T01001                                 

Gene name
NDUFA12, B17.2, DAP13
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A12
  KO
K11352  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    55967 (NDUFA12)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    55967 (NDUFA12)
  Environmental adaptation
   04714 Thermogenesis
    55967 (NDUFA12)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    55967 (NDUFA12)
   05012 Parkinson's disease
    55967 (NDUFA12)
   05016 Huntington's disease
    55967 (NDUFA12)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    55967 (NDUFA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFA12
Motif
Other DBs
NCBI-GeneID: 55967
NCBI-ProteinID: NP_061326
OMIM: 614530
HGNC: 23987
Ensembl: ENSG00000184752
Vega: OTTHUMG00000170098
Pharos: Q9UI09(Tclin)
UniProt: Q9UI09
Structure
PDB: 

Jmol
Position
12q22
AA seq 145 aa AA seqDB search
MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHR
WVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGT
PEQYVPYSTTRKKIQEWIPPSTPYK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggagttagtgcaggtcctgaaacgcgggctgcagcagatcaccggccacggcggtctc
cgaggctatctacgggtttttttcaggacaaatgatgcgaaggttggtacattagtgggg
gaagacaaatatggaaacaaatactatgaagacaacaagcaattttttggccgtcaccga
tgggttgtatatactactgaaatgaatggcaaaaacacattctgggatgtggatggaagc
atggtgcctcctgaatggcatcgttggcttcacagtatgactgatgatcctccaacaaca
aaaccacttactgctcgtaaattcatttggacgaaccataaattcaacgtgactggcacc
ccagaacaatatgtaccttattctaccactagaaagaagattcaggagtggatcccacct
tcaacaccttacaagtaa

DBGET integrated database retrieval system