KEGG   Homo sapiens (human): 55967Help
Entry
55967             CDS       T01001                                 

Gene name
NDUFA12, B17.2, DAP13
Definition
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12
Orthology
K11352  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Disease
H01354  
Leigh syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    55967 (NDUFA12)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    55967 (NDUFA12)
   05012 Parkinson's disease
    55967 (NDUFA12)
   05016 Huntington's disease
    55967 (NDUFA12)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    55967 (NDUFA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q22
AA seq 63 aa AA seqDB search
MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGIVG
FTV
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atggagttagtgcaggtcctgaaacgcgggctgcagcagatcaccggccacggcggtctc
cgaggctatctacgggtttttttcaggacaaatgatgcgaaggttggtacattagtgggg
gaagacaaatatggaaacaaatactatgaagacaacaagcaattttttggcatcgttggc
ttcacagtatga

DBGET integrated database retrieval system