KEGG   Homo sapiens (human): 5598Help
Entry
5598              CDS       T01001                                 

Gene name
MAPK7, BMK1, ERK4, ERK5, PRKM7
Definition
mitogen-activated protein kinase 7 (EC:2.7.11.24)
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 816 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATS
TSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaaacacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctgaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgactgag
tatgtggccacgcgctggtaccgtgcgcccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactatgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgctcgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgcgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccacca
tgccccggccctgcacctgacaccattgatctgaccctgcagccacctccaccagtcagt
gagcctgccccaccaaagaaagatggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagcgcacccctggag
gctcctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttggaacgctggactcgaatggcccggcccgcagcc
ccagccctcacctctgtgccggcccctgccccagcgccaacgccaaccccaaccccagtc
caacctaccagtcctcctcctggccctgtagcccagcccactggcccgcaaccacaatct
gcgggctctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccc
caccccactggccctcctgggcccatccctgtccccgcgccaccccagattgccacctcc
accagcctcctggctgcccagtcacttgtgccaccccctgggctgcctggctccagcacc
ccaggagttttgccttacttcccacctggcctgccgcccccagacgccgggggagcccct
cagtcttccatgtcagagtcacctgatgtcaaccttgtgacccagcagctatctaagtca
caggtggaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggc
tacggtgttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggct
gatgggccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgac
tggctcgaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccag
atggactccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system