KEGG   Homo sapiens (human): 5600Help
Entry
5600              CDS       T01001                                 

Gene name
MAPK11, P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Definition
mitogen-activated protein kinase 11 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5600 (MAPK11)
   04010 MAPK signaling pathway
    5600 (MAPK11)
   04370 VEGF signaling pathway
    5600 (MAPK11)
   04668 TNF signaling pathway
    5600 (MAPK11)
   04068 FoxO signaling pathway
    5600 (MAPK11)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5600 (MAPK11)
   04620 Toll-like receptor signaling pathway
    5600 (MAPK11)
   04621 NOD-like receptor signaling pathway
    5600 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    5600 (MAPK11)
   04660 T cell receptor signaling pathway
    5600 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    5600 (MAPK11)
   04670 Leukocyte transendothelial migration
    5600 (MAPK11)
  Endocrine system
   04912 GnRH signaling pathway
    5600 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    5600 (MAPK11)
   04917 Prolactin signaling pathway
    5600 (MAPK11)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5600 (MAPK11)
  Nervous system
   04728 Dopaminergic synapse
    5600 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    5600 (MAPK11)
   04722 Neurotrophin signaling pathway
    5600 (MAPK11)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5600 (MAPK11)
  Development
   04380 Osteoclast differentiation
    5600 (MAPK11)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5600 (MAPK11)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5600 (MAPK11)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5600 (MAPK11)
   05132 Salmonella infection
    5600 (MAPK11)
   05131 Shigellosis
    5600 (MAPK11)
   05133 Pertussis
    5600 (MAPK11)
   05152 Tuberculosis
    5600 (MAPK11)
   05164 Influenza A
    5600 (MAPK11)
   05160 Hepatitis C
    5600 (MAPK11)
   05169 Epstein-Barr virus infection
    5600 (MAPK11)
   05145 Toxoplasmosis
    5600 (MAPK11)
   05140 Leishmaniasis
    5600 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    5600 (MAPK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5600 (MAPK11)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   5600 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.33
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcccggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggatttcgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccaaacagtggatatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaaaatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgcagct
gaggcactggcccacgcctacttcagccagtaccacgaccccgaggatgagccagaggcc
gagccatatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acttaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

DBGET integrated database retrieval system