KEGG   Homo sapiens (human): 5602Help
Entry
5602              CDS       T01001                                 

Gene name
MAPK10, JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
Definition
mitogen-activated protein kinase 10 (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Non-alcoholic fatty liver disease (NAFLD)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Module
MAPK (JNK) signaling
Disease
H00606  
Early infantile epileptic encephalopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5602 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5602 (MAPK10)
   04010 MAPK signaling pathway
    5602 (MAPK10)
   04012 ErbB signaling pathway
    5602 (MAPK10)
   04310 Wnt signaling pathway
    5602 (MAPK10)
   04668 TNF signaling pathway
    5602 (MAPK10)
   04068 FoxO signaling pathway
    5602 (MAPK10)
   04024 cAMP signaling pathway
    5602 (MAPK10)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    5602 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    5602 (MAPK10)
   04621 NOD-like receptor signaling pathway
    5602 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    5602 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    5602 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    5602 (MAPK10)
   04920 Adipocytokine signaling pathway
    5602 (MAPK10)
   04912 GnRH signaling pathway
    5602 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    5602 (MAPK10)
   04917 Prolactin signaling pathway
    5602 (MAPK10)
  Nervous system
   04728 Dopaminergic synapse
    5602 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    5602 (MAPK10)
   04722 Neurotrophin signaling pathway
    5602 (MAPK10)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5602 (MAPK10)
  Development
   04380 Osteoclast differentiation
    5602 (MAPK10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5602 (MAPK10)
   05231 Choline metabolism in cancer
    5602 (MAPK10)
   05210 Colorectal cancer
    5602 (MAPK10)
   05212 Pancreatic cancer
    5602 (MAPK10)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5602 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5602 (MAPK10)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5602 (MAPK10)
   05132 Salmonella infection
    5602 (MAPK10)
   05131 Shigellosis
    5602 (MAPK10)
   05133 Pertussis
    5602 (MAPK10)
   05152 Tuberculosis
    5602 (MAPK10)
   05164 Influenza A
    5602 (MAPK10)
   05161 Hepatitis B
    5602 (MAPK10)
   05160 Hepatitis C
    5602 (MAPK10)
   05168 Herpes simplex infection
    5602 (MAPK10)
   05169 Epstein-Barr virus infection
    5602 (MAPK10)
   05145 Toxoplasmosis
    5602 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    5602 (MAPK10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5602 (MAPK10)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   5602 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q22.1-q23
AA seq 422 aa AA seqDB search
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSAQV
QQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtttgtgcc
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaagcacctc
cattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaac
gtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcagcacaggtg
cagcagtga

DBGET integrated database retrieval system