KEGG   Homo sapiens (human): 5603Help
Entry
5603              CDS       T01001                                 

Gene name
MAPK13, MAPK_13, MAPK-13, PRKM13, SAPK4, p38delta
Definition
mitogen-activated protein kinase 13 (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Amyotrophic lateral sclerosis (ALS)
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Epstein-Barr virus infection
Proteoglycans in cancer
Module
MAPK (p38) signaling
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5603 (MAPK13)
   04010 MAPK signaling pathway
    5603 (MAPK13)
   04370 VEGF signaling pathway
    5603 (MAPK13)
   04668 TNF signaling pathway
    5603 (MAPK13)
   04068 FoxO signaling pathway
    5603 (MAPK13)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    5603 (MAPK13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5603 (MAPK13)
   04620 Toll-like receptor signaling pathway
    5603 (MAPK13)
   04621 NOD-like receptor signaling pathway
    5603 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    5603 (MAPK13)
   04660 T cell receptor signaling pathway
    5603 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    5603 (MAPK13)
   04670 Leukocyte transendothelial migration
    5603 (MAPK13)
  Endocrine system
   04912 GnRH signaling pathway
    5603 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    5603 (MAPK13)
   04917 Prolactin signaling pathway
    5603 (MAPK13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5603 (MAPK13)
  Nervous system
   04728 Dopaminergic synapse
    5603 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    5603 (MAPK13)
   04722 Neurotrophin signaling pathway
    5603 (MAPK13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5603 (MAPK13)
  Development
   04380 Osteoclast differentiation
    5603 (MAPK13)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5603 (MAPK13)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    5603 (MAPK13)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5603 (MAPK13)
   05132 Salmonella infection
    5603 (MAPK13)
   05131 Shigellosis
    5603 (MAPK13)
   05133 Pertussis
    5603 (MAPK13)
   05152 Tuberculosis
    5603 (MAPK13)
   05164 Influenza A
    5603 (MAPK13)
   05160 Hepatitis C
    5603 (MAPK13)
   05169 Epstein-Barr virus infection
    5603 (MAPK13)
   05145 Toxoplasmosis
    5603 (MAPK13)
   05140 Leishmaniasis
    5603 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    5603 (MAPK13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5603 (MAPK13)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   5603 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 365 aa AA seqDB search
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagacagcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
tatgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactctgctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagacgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

DBGET integrated database retrieval system