KEGG   Homo sapiens (human): 5609Help
Entry
5609              CDS       T01001                                 

Gene name
MAP2K7, JNKK2, MAPKK7, MEK, MEK_7, MKK7, PRKMK7, SAPKK-4, SAPKK4
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Tight junction
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Relaxin signaling pathway
Influenza A
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Fluid shear stress and atherosclerosis
Module
MAPK (JNK) signaling
Network
N00188  
IL1-IL1R-JNK signaling pathway
N00189  
KSHV K15 to JNK signaling pathway
N00207  
KSHV K15 to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5609 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5609 (MAP2K7)
   04012 ErbB signaling pathway
    5609 (MAP2K7)
   04668 TNF signaling pathway
    5609 (MAP2K7)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    5609 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    5609 (MAP2K7)
   04660 T cell receptor signaling pathway
    5609 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    5609 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    5609 (MAP2K7)
   04926 Relaxin signaling pathway
    5609 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    5609 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    5609 (MAP2K7)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5609 (MAP2K7)
  Infectious diseases
   05164 Influenza A
    5609 (MAP2K7)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    5609 (MAP2K7)
   05169 Epstein-Barr virus infection
    5609 (MAP2K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5609 (MAP2K7)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   5609 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14733(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 419 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggaacagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcagagagc
tccccgcagcaccccacgccccccgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctg
gagaacttgggcgagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccgg
aagaccggccacgtcattgccgttaagcaaatgcggcgctccgggaacaaggaggagaac
aagcgcatcctcatggacctggatgtggtgctgaagagccacgactgcccctacatcgtg
cagtgctttgggacgttcatcaccaacacggacgtcttcatcgccatggagctcatgggc
acctgcgctgagaagctcaagaagcggatgcagggccccatccccgagcgcattctgggc
aagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctctgc
gacttcggcatcagcggccgcctggtggactccaaagccaagacgcggagcgccggctgt
gccgcctacatggcacccgagcgcattgaccccccagaccccaccaagccggactatgac
atccgggccgacgtatggagcctgggcatctcgttggtggagctggcaacaggacagttt
ccctacaagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagagccc
ccgcttctgcccggacacatgggcttctcgggggacttccagtccttcgtcaaagactgc
cttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagcttcatc
aagcgctacgagacgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaag
actgagtcaccgcggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

DBGET integrated database retrieval system