KEGG   Homo sapiens (human): 5609Help
Entry
5609              CDS       T01001                                 

Gene name
MAP2K7, JNKK2, MAPKK7, MEK, MEK_7, MKK7, PRKMK7, SAPKK-4, SAPKK4
Definition
mitogen-activated protein kinase kinase 7 (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5609 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5609 (MAP2K7)
   04012 ErbB signaling pathway
    5609 (MAP2K7)
   04668 TNF signaling pathway
    5609 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    5609 (MAP2K7)
   04660 T cell receptor signaling pathway
    5609 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    5609 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    5609 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    5609 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    5609 (MAP2K7)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    5609 (MAP2K7)
   05169 Epstein-Barr virus infection
    5609 (MAP2K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5609 (MAP2K7)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   5609 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 435 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESP
RTSGVLSQPHLPFFR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggaacagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccaacgagcagccctgcag
ctcccgctggccaacgatgggggcagccgctcgccatcctcagagagctccccgcagcac
cccacgccccccgcccggccccgccacatgctggggctcccgtcaaccctgttcacaccc
cgcagcatggagagcattgagattgaccagaagctgcaggagatcatgaagcagacgggc
tacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctggagaacttgggc
gagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccggaagaccggccac
gtcattgccgttaagcaaatgcggcgctccgggaacaaggaggagaacaagcgcatcctc
atggacctggatgtggtgctgaagagccacgactgcccctacatcgtgcagtgctttggg
acgttcatcaccaacacggacgtcttcatcgccatggagctcatgggcacctgcgctgag
aagctcaagaagcggatgcagggccccatccccgagcgcattctgggcaagatgacagtg
gcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatccaccgcgacgtc
aagccctccaacatcctgctggacgagcggggccagatcaagctctgcgacttcggcatc
agcggccgcctggtggactccaaagccaagacgcggagcgccggctgtgccgcctacatg
gcacccgagcgcattgaccccccagaccccaccaagccggactatgacatccgggccgac
gtatggagcctgggcatctcgttggtggagctggcaacaggacagtttccctacaagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagagcccccgcttctgccc
ggacacatgggcttctcgggggacttccagtccttcgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcgctacgag
acgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaagactgagtcaccg
cggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

DBGET integrated database retrieval system