KEGG   Homo sapiens (human): 5609Help
Entry
5609              CDS       T01001                                 

Gene name
MAP2K7, Jnkk2, MAPKK7, MKK7, PRKMK7, SAPKK-4, SAPKK4
Definition
mitogen-activated protein kinase kinase 7 (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3-p13.2
AA seq 419 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggaacagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcagagagc
tccccgcagcaccccacgccccccgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctg
gagaacttgggcgagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccgg
aagaccggccacgtcattgccgttaagcaaatgcggcgctccgggaacaaggaggagaac
aagcgcatcctcatggacctggatgtggtgctgaagagccacgactgcccctacatcgtg
cagtgctttgggacgttcatcaccaacacggacgtcttcatcgccatggagctcatgggc
acctgcgctgagaagctcaagaagcggatgcagggccccatccccgagcgcattctgggc
aagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctctgc
gacttcggcatcagcggccgcctggtggactccaaagccaagacgcggagcgccggctgt
gccgcctacatggcacccgagcgcattgaccccccagaccccaccaagccggactatgac
atccgggccgacgtatggagcctgggcatctcgttggtggagctggcaacaggacagttt
ccctacaagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagagccc
ccgcttctgcccggacacatgggcttctcgggggacttccagtccttcgtcaaagactgc
cttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagcttcatc
aagcgctacgagacgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaag
actgagtcaccgcggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

DBGET integrated database retrieval system