KEGG   Homo sapiens (human): 5610Help
Entry
5610              CDS       T01001                                 

Gene name
EIF2AK2, EIF2AK1, PKR, PPP1R83, PRKR
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2 (EC:2.7.11.1 2.7.10.2)
  KO
K16195  
eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5610 (EIF2AK2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5610 (EIF2AK2)
  Infectious diseases
   05162 Measles
    5610 (EIF2AK2)
   05164 Influenza A
    5610 (EIF2AK2)
   05160 Hepatitis C
    5610 (EIF2AK2)
   05168 Herpes simplex infection
    5610 (EIF2AK2)
   05169 Epstein-Barr virus infection
    5610 (EIF2AK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5610 (EIF2AK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  PEK family [OT]
   5610 (EIF2AK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5610 (EIF2AK2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     5610 (EIF2AK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p22-p21
AA seq 551 aa AA seqDB search
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgatctttcagcaggtttcttcatggaggaacttaatacataccgtcagaag
cagggagtagtacttaaatatcaagaactgcctaattcaggacctccacatgataggagg
tttacatttcaagttataatagatggaagagaatttccagaaggtgaaggtagatcaaag
aaggaagcaaaaaatgccgcagccaaattagctgttgagatacttaataaggaaaagaag
gcagttagtcctttattattgacaacaacgaattcttcagaaggattatccatggggaat
tacataggccttatcaatagaattgcccagaagaaaagactaactgtaaattatgaacag
tgtgcatcgggggtgcatgggccagaaggatttcattataaatgcaaaatgggacagaaa
gaatatagtattggtacaggttctactaaacaggaagcaaaacaattggccgctaaactt
gcatatcttcagatattatcagaagaaacctcagtgaaatctgactacctgtcctctggt
tcttttgctactacgtgtgagtcccaaagcaactctttagtgaccagcacactcgcttct
gaatcatcatctgaaggtgacttctcagcagatacatcagagataaattctaacagtgac
agtttaaacagttcttcgttgcttatgaatggtctcagaaataatcaaaggaaggcaaaa
agatctttggcacccagatttgaccttcctgacatgaaagaaacaaagtatactgtggac
aagaggtttggcatggattttaaagaaatagaattaattggctcaggtggatttggccaa
gttttcaaagcaaaacacagaattgacggaaagacttacgttattaaacgtgttaaatat
aataacgagaaggcggagcgtgaagtaaaagcattggcaaaacttgatcatgtaaatatt
gttcactacaatggctgttgggatggatttgattatgatcctgagaccagtgatgattct
cttgagagcagtgattatgatcctgagaacagcaaaaatagttcaaggtcaaagactaag
tgccttttcatccaaatggaattctgtgataaagggaccttggaacaatggattgaaaaa
agaagaggcgagaaactagacaaagttttggctttggaactctttgaacaaataacaaaa
ggggtggattatatacattcaaaaaaattaattcatagagatcttaagccaagtaatata
ttcttagtagatacaaaacaagtaaagattggagactttggacttgtaacatctctgaaa
aatgatggaaagcgaacaaggagtaagggaactttgcgatacatgagcccagaacagatt
tcttcgcaagactatggaaaggaagtggacctctacgctttggggctaattcttgctgaa
cttcttcatgtatgtgacactgcttttgaaacatcaaagtttttcacagacctacgggat
ggcatcatctcagatatatttgataaaaaagaaaaaactcttctacagaaattactctca
aagaaacctgaggatcgacctaacacatctgaaatactaaggaccttgactgtgtggaag
aaaagcccagagaaaaatgaacgacacacatgttag

DBGET integrated database retrieval system