KEGG   Homo sapiens (human): 56267Help
Entry
56267             CDS       T01001                                 

Gene name
CCBL2, KAT3, KATIII, RP4-531M19.2
Definition
cysteine conjugate-beta lyase 2 (EC:2.6.1.7 4.4.1.13 2.6.1.63)
Orthology
K00816  
kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Selenocompound metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:hsa00450]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22.2
AA seq 454 aa AA seqDB search
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggcccagaggagcctctgctctcttagcggtagagcaaaattcctgaagaca
atttcttcttccaaaatcctcggattctctacttctgctaaaatgtcactgaaattcaca
aatgcaaaacggattgaaggacttgatagtaatgtgtggattgaatttaccaaattggct
gcagacccttctgttgtgaatcttggccaaggctttccagatatatcccctcctacatat
gtaaaagaagaattatcaaagattgcagcaatcgatagcctgaatcagtatacacgaggc
tttggccatccatcacttgtgaaagctctgtcctatctgtatgaaaagctttatcaaaag
caaattgattcaaataaagaaatccttgtgacagtaggagcatatggatctctttttaac
accattcaagcattaattgatgagggagatgaagtcatactaatagtgcctttctatgac
tgctatgagcccatggtgagaatggctggagcaacacctgtttttattcccctgagatct
aaacctgtttatggaaaaagatggtctagttctgactggacattagatcctcaagaactg
gaaagtaaatttaattccaaaaccaaagctattatactaaatactccacataacccactt
ggcaaggtgtataacagagaggaactgcaagtaattgctgacctttgcatcaaatatgac
acactctgcatcagcgatgaggtttatgaatggcttgtatattctggaaataagcactta
aaaatagctacttttccaggtatgtgggagagaacaataacaataggaagtgctggaaag
actttcagtgtaactggctggaagcttggctggtccattggtccaaatcatttgataaaa
catttacagacagttcaacaaaacacgatttatacttgtgcaactcctttacaggaagcc
ttggctcaagctttctggattgacatcaagcgcatggatgacccagaatgttactttaat
tctttgccaaaagagttagaagtaaaaagagatcggatggtacgtttacttgaaagtgtt
ggcctaaaacccatagttcctgatggaggatacttcatcatcgctgatgtgtctttgcta
gatccagacctctctgatatgaagaataatgagccttatgactataagtttgtgaaatgg
atgactaaacataagaaactatcagccatccccgtttcagcattctgtaactcagagact
aaatcacagtttgagaagtttgtgcgtttttgcttcattaaaaaagacagcacactggat
gctgctgaagaaatcatcaaggcatggagtgtacagaagtcttga

DBGET integrated database retrieval system