KEGG   Homo sapiens (human): 56267Help
Entry
56267             CDS       T01001                                 

Gene name
CCBL2, KAT3, KATIII
Definition
cysteine conjugate-beta lyase 2 (EC:2.6.1.7 4.4.1.13 2.6.1.63)
Orthology
K00816  
kynurenine---oxoglutarate transaminase / cysteine-S-conjugate beta-lyase / glutamine---phenylpyruvate transaminase [EC:2.6.1.7 4.4.1.13 2.6.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Selenocompound metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    56267 (CCBL2)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    56267 (CCBL2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    56267 (CCBL2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.7  kynurenine---oxoglutarate transaminase
     56267 (CCBL2)
    2.6.1.64  glutamine---phenylpyruvate transaminase
     56267 (CCBL2)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     56267 (CCBL2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   56267 (CCBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22.2
AA seq 454 aa AA seqDB search
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggcccagaggagcctctgctctcttagcggtagagcaaaattcctgaagaca
atttcttcttccaaaatcctcggattctctacttctgctaaaatgtcactgaaattcaca
aatgcaaaacggattgaaggacttgatagtaatgtgtggattgaatttaccaaattggct
gcagacccttctgttgtgaatcttggccaaggctttccagatatatcccctcctacatat
gtaaaagaagaattatcaaagattgcagcaatcgatagcctgaatcagtatacacgaggc
tttggccatccatcacttgtgaaagctctgtcctatctgtatgaaaagctttatcaaaag
caaattgattcaaataaagaaatccttgtgacagtaggagcatatggatctctttttaac
accattcaagcattaattgatgagggagatgaagtcatactaatagtgcctttctatgac
tgctatgagcccatggtgagaatggctggagcaacacctgtttttattcccctgagatct
aaacctgtttatggaaaaagatggtctagttctgactggacattagatcctcaagaactg
gaaagtaaatttaattccaaaaccaaagctattatactaaatactccacataacccactt
ggcaaggtgtataacagagaggaactgcaagtaattgctgacctttgcatcaaatatgac
acactctgcatcagcgatgaggtttatgaatggcttgtatattctggaaataagcactta
aaaatagctacttttccaggtatgtgggagagaacaataacaataggaagtgctggaaag
actttcagtgtaactggctggaagcttggctggtccattggtccaaatcatttgataaaa
catttacagacagttcaacaaaacacgatttatacttgtgcaactcctttacaggaagcc
ttggctcaagctttctggattgacatcaagcgcatggatgacccagaatgttactttaat
tctttgccaaaagagttagaagtaaaaagagatcggatggtacgtttacttgaaagtgtt
ggcctaaaacccatagttcctgatggaggatacttcatcatcgctgatgtgtctttgcta
gatccagacctctctgatatgaagaataatgagccttatgactataagtttgtgaaatgg
atgactaaacataagaaactatcagccatccccgtttcagcattctgtaactcagagact
aaatcacagtttgagaagtttgtgcgtttttgcttcattaaaaaagacagcacactggat
gctgctgaagaaatcatcaaggcatggagtgtacagaagtcttga

DBGET integrated database retrieval system