KEGG   Homo sapiens (human): 5646Help
Entry
5646              CDS       T01001                                 

Gene name
PRSS3, MTG, PRSS4, T9, TRY3, TRY4
Definition
protease, serine, 3 (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Drug target
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p11.2
AA seq 261 aa AA seqDB search
MHMRETSGFTLKKGRSAPLVFHPPDALIAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSH
FCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDN
DIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVL
TQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRP
GVYTKVYNYVDWIKDTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagagagacaagtggcttcacattgaagaaggggaggagtgcgccattggtt
ttccatcctccagatgcactgattgctgtcccctttgacgatgatgacaagattgttggg
ggctacacctgtgaggagaattctctcccctaccaggtgtccctgaattctggctcccac
ttctgcggtggctccctcatcagcgaacagtgggtggtatcagcagctcactgctacaag
acccgcatccaggtgagactgggagagcacaacatcaaagtcctggaggggaatgagcag
ttcatcaatgcggccaagatcatccgccaccctaaatacaacagggacactctggacaat
gacatcatgctgatcaaactctcctcacctgccgtcatcaatgcccgcgtgtccaccatc
tctctgcccaccgcccctccagctgctggcactgagtgcctcatctccggctggggcaac
actctgagctttggtgctgactacccagacgagctgaagtgcctggatgctccggtgctg
acccaggctgagtgtaaagcctcctaccctggaaagattaccaacagcatgttctgtgtg
ggcttccttgagggaggcaaggattcctgccagcgtgactctggtggccctgtggtctgc
aacggacagctccaaggagttgtctcctggggccatggctgtgcctggaagaacaggcct
ggagtctacaccaaggtctacaactatgtggactggattaaggacaccatcgctgccaac
agctaa

DBGET integrated database retrieval system