KEGG   Homo sapiens (human): 5653Help
Entry
5653              CDS       T01001                                 

Gene name
KLK6, Bssp, Klk7, PRSS18, PRSS9, SP59, hK6
Definition
kallikrein-related peptidase 6
Orthology
K08667  
kallikrein 6 (neurosin, zyme) [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     5653 (KLK6)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5653 (KLK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 244 aa AA seqDB search
MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTA
AHCKKPNLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSE
LIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNM
LCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKT
IQAK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctgatggtggtgctgagtctgattgctgcagcctgggcagaggagcagaat
aagttggtgcatggcggaccctgcgacaagacatctcacccctaccaagctgccctctac
acctcgggccacttgctctgtggtggggtccttatccatccactgtgggtcctcacagct
gcccactgcaaaaaaccgaatcttcaggtcttcctggggaagcataaccttcggcaaagg
gagagttcccaggagcagagttctgttgtccgggctgtgatccaccctgactatgatgcc
gccagccatgaccaggacatcatgctgttgcgcctggcacgcccagccaaactctctgaa
ctcatccagccccttcccctggagagggactgctcagccaacaccaccagctgccacatc
ctgggctggggcaagacagcagatggtgatttccctgacaccatccagtgtgcatacatc
cacctggtgtcccgtgaggagtgtgagcatgcctaccctggccagatcacccagaacatg
ttgtgtgctggggatgagaagtacgggaaggattcctgccagggtgattctgggggtccg
ctggtatgtggagaccacctccgaggccttgtgtcatggggtaacatcccctgtggatca
aaggagaagccaggagtctacaccaacgtctgcagatacacgaactggatccaaaaaacc
attcaggccaagtga

DBGET integrated database retrieval system