KEGG   Homo sapiens (human): 56623Help
Entry
56623             CDS       T01001                                 

Gene name
INPP5E, CORS1, CPD4, JBTS1, MORMS, PPI5PIV
Definition
inositol polyphosphate-5-phosphatase, 72 kDa (EC:3.1.3.36)
Orthology
K01099  
phosphatidylinositol-bisphosphatase [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Disease
H00530  
Joubert syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    56623 (INPP5E)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    56623 (INPP5E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     56623 (INPP5E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 644 aa AA seqDB search
MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSG
EDPPARAAPIAPRPPARPRLERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEG
PGAPAHSCSPPCLSTSLQEIPKSRGVLSSERGSPSSGGNPLSGVASSSPNLPHRDAAVAG
SSPRLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPR
SPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVA
LFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWETRLQETLGPHY
VLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLF
ITSHFTSGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFDEVFWFGDFNF
RLSGGRTVVDALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGK
DTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRD
NIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaaggcggagaatctgcggccctccgagccggccccgcagccgccggaaggg
aggacgctccaaggacagcttcccggcgctccgccggcccagcgcgcggggtccccaccc
gatgctccgggctccgagagccccgcgcttgcctgcagcactccggccacgcccagcggc
gaggacccgccagcccgagcagcacccatcgccccgcggccccccgccaggcctcgactg
gagcgagccctgtccctggacgacaagggctggaggaggaggcgttttcgaggcagccag
gaggacctggaagcccggaatgggaccagtccctccaggggctcagtgcagagcgagggc
cccggggcccccgcccacagctgctccccgccctgcctgagcacctccttgcaggaaatc
cccaagtcccgcggggtcctgagcagtgagagagggagcccgtcctcggggggtaaccct
ctctctggggtggccagcagctccccgaacctcccgcacagagacgccgccgtggcgggg
agctcgcccaggctgcccagcctgctgcccccgcgcccaccgcctgccctgagcctggac
atcgcctccgactccctgaggacagcaaacaaggtcgactcggatcttgcagactacaag
ctccgcgcgcagccgctcctggtgcgggcccacagcagcctgggccccggccggccgcgg
agccccctggcctgcgacgactgttcccttcgctcggccaaatcctccttcagcctcctg
gcgcccatccgcagcaaggacgtccgcagcaggagttacctggagggcagcctcctggcc
agcggggccctgttgggggcggatgagctggcccgctacttcccagaccggaacgtggca
ctcttcgtggccacctggaacatgcagggccagaaggagctcccgcccagcctggacgag
ttcctgctcccagccgaggccgactatgcccaggacctgtatgtcatcggggtccaggag
ggctgttctgacaggcgggagtgggagactcgtctgcaggagacgctgggcccgcactat
gtgctgctgtcctcggcggcccacggcgtgctctacatgtcgctcttcatccgcagggac
ctcatctggttctgctcagaggtggagtgctccacggtgaccacacgcatcgtgtctcag
atcaagaccaagggggccttgggcatcagcttcaccttttttggcacttccttcctcttc
atcacgtcccacttcacctcaggtgacgggaaggtggcggagcggctgctggactacacc
aggactgtacaagccctggtcctgcccagaaatgtgcccgacaccaacccctatcgctcc
agcgcagcggacgtcaccacccgcttcgatgaggtgttctggtttggagacttcaacttc
cgcctgagtggcgggcgcacagtcgtggacgccctcctgtgccagggcctggtggtggac
gtgccggcgctgctgcagcacgaccagctcatccgggagatgcggaaagggtccatcttc
aagggcttccaggagccggacatccacttcctcccatcatacaagtttgacatcgggaag
gacacgtacgacagcacctccaagcagaggacgccctcatacacggaccgcgtcttgtac
agaagccgccacaagggtgacatctgtcctgtgagctactcttcctgccccgggatcaag
acgtccgaccaccgccctgtgtatggcctcttccgggtgaaagtgaggccggggcgagac
aacattccgttggcagctggcaaatttgatagagaactgtacttactaggaattaaaaga
cggatttcgaaggagattcagaggcagcaagcactacagagtcagaactccagcaccatc
tgctccgtttcttga

DBGET integrated database retrieval system