KEGG   Homo sapiens (human): 567Help
Entry
567               CDS       T01001                                 

Gene name
B2M
Definition
beta-2-microglobulin
Orthology
K08055  
beta-2-microglobulin
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Disease
H01303  
Hypercatabolic hypoproteinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    567 (B2M)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   567 (B2M)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 
1K5N 3MRE 2YXF 3CZF 3IB4 3SPV 3MRG 3LN4 3D25 3BWA 2BVP 4FXL 3MRB 3MRK 2A83 1OGA 1I4F 1X7Q 1OGT 1XH3 4JQV 3VFN 2HJL 2FYY 1ZHL 3VFV 2GTW 1UXS 3QDA 4G8I 4G9D 3VRI 3SKO 3PWN 3MYZ 3MRR 3KPM 3GSO 3DX7 3BGM 2V2W 2V2X 2HN7 1ZHK 1M6O 3V5H 3VFU 3TID 3PWL 3KLA 3FQN 3BH8 2BVO 3UTQ 3QFD 4F7T 3VFO 3VCL 3PWJ 3OXR 3O3D 3MRD 3L3I 3KYO 3FQR 3FQX 3DX6 3BH9 2NW3 2GTZ 2GIT 2F8O 2D4F 1ZSD 1SYV 1N2R 1UXW 3D18 3OXS 3BW9 2GT9 2CIK 4I4W 1XR9 4HX1 3VXS 3VH8 3SKM 3O3A 3MRC 3LKO 3LKP 3LKQ 3L3D 3GSU 3FT2 3FQT 3FQU 3EKC 3DHM 3BP7 3BO8 3B6S 2Z9T 2H26 2AXF 1TVB 1TVH 1LDS 1I7U 1DUZ 3GSW 3KPQ 3VFP 3VFR 3VFS 3O3E 3BP4 2HJK 1JF1 3BXN 3B3I 3MRJ 3C9N 3H7B 3MYJ 2P5E 4L4V 4JQX 4JFQ 4G9F 4F7P 3VRJ 3VFM 3T8X 3REW 3O3B 3NA4 3MRM 2X4Q 3LN5 3LKS 3KPP 3GSV 3GJF 3FT4 2H6P 2GUO 2FZ3 1YDP 1T1Z 1M05 1JGD 1HSB 4JFP 3MR9 3FQW 3LV3 2YPK 3VXN 4E5X 3VFT 3HCV 3GSR 3FT3 2AV1 3KPL 4NQX 4L4T 4K7F 3V5D 3UPR 3RL1 3MV7 2X70 3LKN 3LKR 3KPN 3HPJ 3H9H 3GIV 3DHJ 3DBX 2AXG 1T1Y 1LP9 1A1N 2CLR 2AV7 1AGD 1VGK 3MV8 3MRI 3MRP 2X4U 3L3G 3IXA 3GSX 3DX8 3DTX 2F53 2D4D 1JGE 1AGC 1HSA 4JFO 3GSQ 1W72 1ONQ 1JHT 1DUY 3OX8 2X89 3KWW 1T21 3MRQ 3MGT 3I6G 3BHB 2P5W 1T1W 1T1X 1T20 1T22 1S9W 1S8D 1IM3 1I7R 1E27 1I1Y 1QEW 1AGB 1AGF 3D2U 1QVO 3TIE 1EEY 1GZQ 1W0V 3QFJ 4JRX 3VFW 3QDJ 3MRF 3MRN 3MGO 3LOW 2X4O 2X4P 2X4R 2X4T 3KPO 2PYE 1XR8 1S9Y 1EEZ 1A1M 1A1O 1AGE 1TMC 3V5K 2X4N 4GKS 3MRO 2C7U 4NQV 3RL2 3NFN 4LCW 4K71 4HWZ 2YPL 3VXR 4G8G 4F7M 3MRH 3L3J 3KYN 3I6L 2UWE 1SYS 1Q94 1QR1 3MRL 4BEO 4JFF 3TLR 4JFD 4N8V 3VXM 3VXP 3OV6 3HUJ 3BZE 3BZF 2VLK 2RFX 2DYP 2AK4 1S9X 1R3H 1MI5 1B0G 1BD2 1A9E 1HHI 1HHJ 1HHK 3O4L 2X4S 3BVN 2CII 2GJ6 4EN3 3QEQ 4KDT 3W0W 3UTT 3TO2 2XPG 3M17 3L3K 3KPR 2ESV 1A6Z 1AO7 1HHG 3HLA 2HLA 3VXO 4L3C 1QLF 1AKJ 4EUQ 3QDG 3PWP 4JFE 3VXU 3TM6 3RWJ 3MZT 3MV9 3KPS 3H9S 2NX5 2F74 2F54 1EXU 1QQD 1CG9 3UTS 4MNQ 4FTV 4JRY 4I48 3U0P 3QZW 3QDM 3AM8 3JTS 3I6K 3GSN 3FFC 3D3V 2BCK 1ZVS 1XZ0 1KPR 1IM9 1I7T 1DE4 1QSE 1QSF 1QRN 1I1F 3D39 1MHE 4LHU 4EUP 2J8U 3HAE 3CIQ 1PY4 1CE6 1B0R 3VWK 4HKJ 3HG1 1ZS8 1ZT4 1E28 1EFX 1HHH 4N0F 3TZV 4L29 3VWJ 3W39 3SJV 3M1B 3KXF 1KTL 1C16 3SDX 4GUP 2PO6 2D31 1A9B 3CDG 1YPZ 1P7Q 3DXA 1HLA 4N0U 3CII 2XKS 2XKU 2VLJ 2VLL 2VLR 2VB5 2E8D 2JCC 2BVQ 2BSR 2BSS 2BST 2BNQ 2BNR 1W0W 1UQS 1OF2 1GZP 1JNJ
Thumbnails

Jmol
Position
15q21-q22.2
AA seq 119 aa AA seqDB search
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgctccgtggccttagctgtgctcgcgctactctctctttctggcctggaggct
atccagcgtactccaaagattcaggtttactcacgtcatccagcagagaatggaaagtca
aatttcctgaattgctatgtgtctgggtttcatccatccgacattgaagttgacttactg
aagaatggagagagaattgaaaaagtggagcattcagacttgtctttcagcaaggactgg
tctttctatctcttgtactacactgaattcacccccactgaaaaagatgagtatgcctgc
cgtgtgaaccatgtgactttgtcacagcccaagatagttaagtgggatcgagacatgtaa

DBGET integrated database retrieval system