KEGG   Homo sapiens (human): 5691Help
Entry
5691              CDS       T01001                                 

Gene name
PSMB3, HC10-II
Definition
(RefSeq) proteasome subunit beta 3
  KO
K02735  
20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Module
Immunoproteasome
Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5691 (PSMB3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5691 (PSMB3)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T1: proteasome family
   5691 (PSMB3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5691 (PSMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49720(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 205 aa AA seqDB search
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtctattatgtcctataacggaggggccgtcatggccatgaaggggaagaactgtgtg
gccatcgctgcagacaggcgcttcgggatccaggcccagatggtgaccacggacttccag
aagatctttcccatgggtgaccggctgtacatcggtctggccgggctcgccactgacgtc
cagacagttgcccagcgcctcaagttccggctgaacctgtatgagttgaaggaaggtcgg
cagatcaaaccttataccctcatgagcatggtggccaacctcttgtatgagaaacggttt
ggcccttactacactgagccagtcattgccgggttggacccgaagacctttaagcccttc
atttgctctctagacctcatcggctgccccatggtgactgatgactttgtggtcagtggc
acctgcgccgaacaaatgtacggaatgtgtgagtccctctgggagcccaacatggatccg
gatcacctgtttgaaaccatctcccaagccatgctgaatgctgtggaccgggatgcagtg
tcaggcatgggagtcattgtccacatcatcgagaaggacaaaatcaccaccaggacactg
aaggcccgaatggactaa

DBGET integrated database retrieval system