KEGG   Homo sapiens (human): 5696Help
Entry
5696              CDS       T01001                                 

Gene name
PSMB8, ALDD, D6S216, D6S216E, JMP, LMP7, NKJO, PSMB5i, RING10
Definition
(RefSeq) proteasome subunit beta 8
  KO
K02740  
20S proteasome subunit beta 8 [EC:3.4.25.1]
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Module
Immunoproteasome
Disease
H01741  
Autoinflammation lipodystrophy and dermatosis syndrome (ALDD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5696 (PSMB8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     5696 (PSMB8)
Peptidases [BR:hsa01002]
 Threonine Peptidases
  Family T1: proteasome family
   5696 (PSMB8)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    5696 (PSMB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P28062(Tclin)
UniProt: 
Position
6p21.32
AA seq 276 aa AA seqDB search
MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcgctactagatgtatgcggagccccccgagggcagcggccggaatcggctctcccg
gttgcgggaagcgggcgtcgctcggacccaggacactacagtttctctatgcgatctcca
gagctcgctttaccccggggaatgcagcccacagaattcttccagtccctgggtggggac
ggagaaaggaacgttcagattgagatggcccatggcaccaccacgctcgccttcaagttc
cagcatggagtgattgcagcagtggattctcgggcctcagctgggtcctacattagtgcc
ttacgggtgaacaaggtgattgagattaacccttacctgcttggcaccatgtctggctgt
gcagcagactgtcagtactgggagcgcctgctggccaaggaatgcaggctgtactatctg
cgaaatggagaacgtatttcagtgtcggcagcctccaagctgctgtccaacatgatgtgc
cagtaccggggcatgggcctctctatgggcagtatgatctgtggctgggataagaagggt
cctggactctactacgtggatgaacatgggactcggctctcaggaaatatgttctccacg
ggtagtgggaacacttatgcctacggggtcatggacagtggctatcggcctaatcttagc
cctgaagaggcctatgaccttggccgcagggctattgcttatgccactcacagagacagc
tattctggaggcgttgtcaatatgtaccacatgaaggaagatggttgggtgaaagtagaa
agtacagatgtcagtgacctgctgcaccagtaccgggaagccaatcaataa

DBGET integrated database retrieval system