KEGG   Homo sapiens (human): 5700Help
Entry
5700              CDS       T01001                                 

Gene name
PSMC1, P26S4, S4, p56
Definition
proteasome (prosome, macropain) 26S subunit, ATPase, 1
Orthology
K03062  
26S proteasome regulatory subunit T2
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Epstein-Barr virus infection
Viral carcinogenesis
Module
Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5700 (PSMC1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5700 (PSMC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    5700 (PSMC1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5700 (PSMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.11
AA seq 440 aa AA seqDB search
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggtcatggtcctggaggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtaccaactagagtggggaaaaagaagaagaaaaca
aagggaccagatgctgccagcaaactgccactggtgacacctcacactcagtgccggtta
aaattactgaagttagagagaattaaagactatcttctcatggaggaagaattcattaga
aatcaggaacaaatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctgagggggaccccgatgtcagtaggaaccttggaagagatcattgatgacaatcat
gccatcgtgtctacatctgtgggctcagaacactacgtcagcattctttcatttgtagac
aaggatctgctggaacctggctgctcggtcctgctcaaccacaaggtgcatgccgtgata
ggggtgctgatggatgacacggatcccctggtcacagtgatgaaggtagaaaaggccccc
caggagacctatgcagatattggggggttggacaaccaaattcaggaaattaaggaatct
gtggagcttcctctcacccatcctgaatattatgaagagatgggtataaagcctcctaag
ggggtcattctctatggtccacctggcacaggtaaaaccttgttagccaaagcagtagca
aaccaaacctcagccactttcttgagagtggttggctctgaacttattcagaagtaccta
ggtgatgggcccaaactcgtacgggaattgttccgagttgctgaagaacatgcaccgtcc
atcgtgtttattgatgaaattgacgccattgggacaaaaagatatgactccaattctggt
ggtgagagagaaattcagcgaacaatgttggaactgctgaaccagttggatggatttgat
tctaggggagatgtgaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacaggaagattgagttccccctgcctgatgaaaagacg
aagaagcgcatctttcagattcacacaagcaggatgacgctggctgatgatgtaaccctg
gacgacctgatcatggctaaagatgacctctctggtgctgacatcaaggcaatctgtaca
gaagctggtctgatggccttaagagaacgtagaatgaaagtaacaaatgaagacttcaaa
aaatctaaagaaaatgttctttataagaaacaggaaggcacccctgaggggctgtatctc
taa

DBGET integrated database retrieval system