KEGG   Homo sapiens (human): 5700Help
Entry
5700              CDS       T01001                                 

Gene name
PSMC1, P26S4, S4, p56
Definition
(RefSeq) proteasome 26S subunit, ATPase 1
  KO
K03062  26S proteasome regulatory subunit T2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Module
hsa_M00341  Proteasome, 19S regulatory particle (PA700)
Network
N00194  HPV E7 to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5700 (PSMC1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5700 (PSMC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    5700 (PSMC1)
   05165 Human papillomavirus infection
    5700 (PSMC1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5700 (PSMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_2 AAA_22 DUF815 AAA_5 RuvB_N AAA_16 Prot_ATP_ID_OB IstB_IS21 AAA_18 AAA_33 AAA_25 ATPase AAA_3 AAA_28 RNA_helicase TIP49 AAA_14 PhoH Mg_chelatase NACHT AAA_11 AAA_24 AAA_30 TsaE ABC_tran Parvo_NS1 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 5700
NCBI-ProteinID: NP_002793
OMIM: 602706
HGNC: 9547
Ensembl: ENSG00000100764
Vega: OTTHUMG00000171019
Pharos: P62191(Tbio)
UniProt: P62191 Q53XL8
Structure
PDB: 

Jmol
Position
14q32.11
AA seq 440 aa AA seqDB search
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggtcatggtcctggaggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtaccaactagagtggggaaaaagaagaagaaaaca
aagggaccagatgctgccagcaaactgccactggtgacacctcacactcagtgccggtta
aaattactgaagttagagagaattaaagactatcttctcatggaggaagaattcattaga
aatcaggaacaaatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctgagggggaccccgatgtcagtaggaaccttggaagagatcattgatgacaatcat
gccatcgtgtctacatctgtgggctcagaacactacgtcagcattctttcatttgtagac
aaggatctgctggaacctggctgctcggtcctgctcaaccacaaggtgcatgccgtgata
ggggtgctgatggatgacacggatcccctggtcacagtgatgaaggtagaaaaggccccc
caggagacctatgcagatattggggggttggacaaccaaattcaggaaattaaggaatct
gtggagcttcctctcacccatcctgaatattatgaagagatgggtataaagcctcctaag
ggggtcattctctatggtccacctggcacaggtaaaaccttgttagccaaagcagtagca
aaccaaacctcagccactttcttgagagtggttggctctgaacttattcagaagtaccta
ggtgatgggcccaaactcgtacgggaattgttccgagttgctgaagaacatgcaccgtcc
atcgtgtttattgatgaaattgacgccattgggacaaaaagatatgactccaattctggt
ggtgagagagaaattcagcgaacaatgttggaactgctgaaccagttggatggatttgat
tctaggggagatgtgaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacaggaagattgagttccccctgcctgatgaaaagacg
aagaagcgcatctttcagattcacacaagcaggatgacgctggctgatgatgtaaccctg
gacgacctgatcatggctaaagatgacctctctggtgctgacatcaaggcaatctgtaca
gaagctggtctgatggccttaagagaacgtagaatgaaagtaacaaatgaagacttcaaa
aaatctaaagaaaatgttctttataagaaacaggaaggcacccctgaggggctgtatctc
taa

DBGET integrated database retrieval system