KEGG   Homo sapiens (human): 5704Help
Entry
5704              CDS       T01001                                 

Gene name
PSMC4, MIP224, RPT3, S6, TBP-7, TBP7
Definition
(RefSeq) proteasome 26S subunit, ATPase 4
  KO
K03063  
26S proteasome regulatory subunit T3
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Epstein-Barr virus infection
Module
Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5704 (PSMC4)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    5704 (PSMC4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5704 (PSMC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P43686(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 418 aa AA seqDB search
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggagataggcatcttggtggagaaggctcaggatgagatcccagcactgtccgtg
tcccggccccagaccggcctgtccttcctgggccctgagcctgaggacctggaggacctg
tacagccgctacaagaagctgcagcaagagctggagttcctggaggtgcaggaggaatac
atcaaagatgagcaaaagaacctgaaaaaggaatttctccatgcccaggaggaggtgaag
cgaatccaaagcatcccgctggtcatcggacaatttctggaggctgtggatcagaataca
gccatcgtgggctctaccacaggctccaactattatgtgcgcatcctgagcaccatcgat
cgggagctgctcaagcccaacgcctcagtggccctccacaagcacagcaatgcactggtg
gacgtgctgccccccgaagccgacagcagcatcatgatgctcacctcagaccagaagcca
gatgtgatgtacgcggacatcggaggcatggacatccagaagcaggaggtgcgggaggcc
gtggagctcccgctcacgcatttcgagctctacaagcagatcggcatcgatcccccccga
ggcgtcctcatgtatggcccacctggctgtgggaagaccatgttggcaaaggcggtggca
catcacacaacagctgcattcatccgggtcgtgggctcggagtttgtacagaagtatctg
ggtgagggcccccgcatggtccgggatgtgttccgcctggccaaggagaatgcacctgcc
atcatcttcatagacgagattgatgccatcgccaccaagagattcgatgctcagacaggg
gccgacagggaggttcagaggatcctgctggagctgctgaatcagatggatggatttgat
cagaatgtcaatgtcaaggtaatcatggccacaaacagagcagacaccctggatccggcc
ctgctacggccaggacggctggaccgtaaaattgaatttccacttcctgaccgccgccag
aagagattgattttctccactatcactagcaagatgaacctctctgaggaggttgacttg
gaagactatgtggcccggccagataagatttcaggagctgatattaactccatctgtcag
gagagtggaatgttggctgtccgtgaaaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagactgtcatcaagaaggacgagcaggagcatgagttttacaagtga

DBGET integrated database retrieval system