KEGG   Homo sapiens (human): 5708Help
Entry
5708              CDS       T01001                                 

Gene name
PSMD2, P97, RPN1, S2, TRAP2
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 2
  KO
K03028  
26S proteasome regulatory subunit N1
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Epstein-Barr virus infection
Module
Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5708 (PSMD2)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    5708 (PSMD2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5708 (PSMD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13200(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q27.1
AA seq 908 aa AA seqDB search
MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKR
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggaggagggaggccgggacaaggcgccggtgcagccccagcagtctccagcggcggcc
cccggcggcacggacgagaagccgagcggcaaggagcggcgggatgccggggacaaggac
aaagaacaggagctgtctgaagaggataaacagcttcaagatgaactggagatgctcgtg
gaacgactaggggagaaggatacatccctgtatcgaccagcgctggaggaattgcgaagg
cagattcgttcttctacaacttccatgacttcagtgcccaagcctctcaaatttctgcgt
ccacactatggcaaactgaaggaaatctatgagaacatggcccctggggagaataagcgt
tttgctgctgacatcatctccgttttggccatgaccatgagtggggagcgtgagtgcctc
aagtatcggctagtgggctcccaggaggaattggcatcatggggtcatgagtatgtcagg
catctggcaggagaagtggctaaggagtggcaggagctggatgacgcagagaaggtccag
cgggagcctctgctcactctggtgaaggaaatcgtcccctataacatggcccacaatgca
gagcatgaggcttgcgacctgcttatggaaattgagcaggtggacatgctggagaaggac
attgatgaaaatgcatatgcaaaggtctgcctttatctcaccagttgtgtgaattacgtg
cctgagcctgagaactcagccctactgcgttgtgccctgggtgtgttccgaaagtttagc
cgcttccctgaagctctgagattggcattgatgctcaatgacatggagttggtagaagac
atcttcacctcctgcaaggatgtggtagtacagaaacagatggcattcatgctaggccgg
catggggtgttcctggagctgagtgaagatgtcgaggagtatgaggacctgacagagatc
atgtccaatgtacagctcaacagcaacttcttggccttagctcgggagctggacatcatg
gagcccaaggtgcctgatgacatctacaaaacccacctagagaacaacaggtttgggggc
agtggctctcaggtggactctgcccgcatgaacctggcctcctcttttgtgaatggcttt
gtgaatgcagcttttggccaagacaagctgctaacagatgatggcaacaaatggctttac
aagaacaaggaccacggaatgttgagtgcagctgcatctcttgggatgattctgctgtgg
gatgtggatggtggcctcacccagattgacaagtacctgtactcctctgaggactacatt
aagtcaggagctcttcttgcctgtggcatagtgaactctggggtccggaatgagtgtgac
cctgctctggcactgctctcagactatgttctccacaacagcaacaccatgagacttggt
tccatctttgggctaggcttggcttatgctggctcaaatcgtgaagatgtcctaacactg
ctgctgcctgtgatgggagattcaaagtccagcatggaggtggcaggtgtcacagcttta
gcctgtggaatgatagcagtagggtcctgcaatggagatgtaacttccactatccttcag
accatcatggagaagtcagagactgagctcaaggatacttatgctcgttggcttcctctt
ggactgggtctcaaccacctggggaagggtgaggccatcgaggcaatcctggctgcactg
gaggttgtgtcagagccattccgcagttttgccaacacactggtggatgtgtgtgcatat
gcaggctctgggaatgtgctgaaggtgcagcagctgctccacatttgtagcgaacacttt
gactccaaagagaaggaggaagacaaagacaagaaggaaaagaaagacaaggacaagaag
gaagcccctgctgacatgggagcacatcagggagtggctgttctggggattgcccttatt
gctatgggggaggagattggtgcagagatggcattacgaacctttggccacttgctgaga
tatggggagcctacactccggagggctgtacctttagcactggccctcatctctgtttca
aatccacgactcaacatcctggataccctaagcaaattctctcatgatgctgatccagaa
gtttcctataactccatttttgccatgggcatggtgggcagtggtaccaataatgcccgt
ctggctgcaatgctgcgccagttagctcaatatcatgccaaggacccaaacaacctcttc
atggtgcgcttggcacagggcctgacacatttagggaagggcacccttaccctctgcccc
taccacagcgaccggcagcttatgagccaggtggccgtggctggactgctcactgtgctt
gtctctttcctggatgttcgaaacattattctaggcaaatcacactatgtattgtatggg
ctggtggctgccatgcagccccgaatgctggttacgtttgatgaggagctgcggccattg
ccagtgtctgtccgtgtgggccaggcagtggatgtggtgggccaggctggcaagccgaag
actatcacagggttccagacgcatacaaccccagtgttgttggcccacggggaacgggca
gaattggccactgaggagtttcttcctgttacccccattctggaaggttttgttatcctt
cggaagaaccccaattatgatctctaa

DBGET integrated database retrieval system