KEGG   Homo sapiens (human): 57118Help
Entry
57118             CDS       T01001                                 

Gene name
CAMK1D, CKLiK, CaM-K1, CaMKID
Definition
(RefSeq) calcium/calmodulin dependent protein kinase ID
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
Network
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    57118 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    57118 (CAMK1D)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     57118 (CAMK1D)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   57118 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 APH 5_nucleotid Tyrosinase
Motif
Other DBs
NCBI-GeneID: 57118
NCBI-ProteinID: NP_705718
OMIM: 607957
HGNC: 19341
Ensembl: ENSG00000183049
Vega: OTTHUMG00000017683
Pharos: Q8IU85(Tchem)
UniProt: Q8IU85 Q5SQQ7
Structure
PDB: 

Jmol
Position
10p13
AA seq 385 aa AA seqDB search
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagaacggcgagagcagctcctcctggaaaaagcaagctgaagacatcaag
aagatcttcgagttcaaagagaccctcggaaccggggccttttccgaagtggttttagct
gaagagaaggcaactggcaagctctttgctgtgaagtgtatccctaagaaggcgctgaag
ggcaaggaaagcagcatagagaatgagatagccgtcctgagaaagattaagcatgaaaat
attgttgccctggaagacatttatgaaagcccaaatcacctgtacttggtcatgcagctg
gtgtccggtggagagctgtttgaccggatagtggagaaggggttttatacagagaaggat
gccagcactctgatccgccaagtcttggacgccgtgtactatctccacagaatgggcatc
gtccacagagacctcaagcccgaaaatctcttgtactacagtcaagatgaggagtccaaa
ataatgatcagtgactttggattgtcaaaaatggagggcaaaggagatgtgatgtccact
gcctgtggaactccaggctatgtcgctcctgaagtcctcgcccagaaaccttacagcaaa
gccgttgactgctggtccatcggagtgattgcctacatcttgctctgcggctaccctcct
ttttatgatgaaaatgactccaagctctttgagcagatcctcaaggcggaatatgagttt
gactctccctactgggatgacatctccgactctgcaaaagacttcattcggaacctgatg
gagaaggacccgaataaaagatacacgtgtgagcaggcagctcggcacccatggatcgct
ggtgacacagccctcaacaaaaacatccacgagtccgtcagcgcccagatccggaaaaac
tttgccaagagcaaatggagacaagcatttaatgccacggccgtcgtcagacatatgaga
aaactacacctcggcagcagcctggacagttcaaatgcaagtgtttcgagcagcctcagt
ttggccagccaaaaagactgtctggcaccttccacgctctgtagtttcatttcttcttcg
tcgggggtctcaggagttggagccgagcggagacccaggcccaccactgtgacggcagtg
cactctggaagcaagtga

DBGET integrated database retrieval system