KEGG   Homo sapiens (human): 57134Help
Entry
57134             CDS       T01001                                 

Gene name
MAN1C1, HMIC, MAN1A3, MAN1C, pp6318
Definition
mannosidase, alpha, class 1C, member 1 (EC:3.2.1.113)
Orthology
K01230  
mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
1p35
AA seq 590 aa AA seqDB search
MLMRKVPGFVPASPWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFLAPRTQQ
PGLEVVAEIAGHAPAREQEPPPNPAPAAPAPGEDDPSSWASPRRRKGGLRRTRPTGPREE
ATAARGNSIPASRPGDEGVPFRFDFNAFRSRLRHPVLGTRADESQEPQSQVRAQREKIKE
MMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGGLSGATVIDSLDTLYLMELKEEFQEAK
AWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTG
IPKGVVSFKSGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKI
EKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEA
IETYLLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQ
ITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPI
YREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgaggaaagtgcccggcttcgtcccggcctccccgtgggggctgcggctgccg
cagaagttcctcttcctcctcttcctctcgggcctggtcaccctgtgcttcggggccctc
ttcctgctgccccactcctctcgcctcaagcgcctcttcctggccccccggacccagcag
cctggtctggaagtggtggctgaaatcgccggccatgccccggcccgcgagcaggagccg
cctcccaacccggcccccgccgcgccggccccgggcgaggatgaccccagcagctgggcc
agtccccgccgcaggaaaggggggctgcggcgcacccgccccactggaccccgcgaggag
gccacggcggcccggggcaatagcatcccggcctccaggcccggggacgagggcgtccct
ttccgctttgacttcaacgcattccggagccgtctccgccacccggtcctgggaacgagg
gccgatgagagtcaggagccccagagccaagtgcgagcccagcgggagaaaatcaaggag
atgatgcagtttgcttggcagagctataagcgttatgcaatggggaaaaacgaactccgt
ccactaacaaaagatggctacgagggtaacatgttcggaggcctcagcggggcaacagtc
attgactccctcgataccctctacctcatggagctgaaggaggagttccaggaggccaag
gcctgggtgggagagagcttccacctgaacgtgagcggagaagcatccttgtttgaggtg
aacatccgctacatcgggggactcctctcagccttctacctgacaggagaagaggtgttc
cgaataaaggccatcaggctgggagagaagctcctgccggcgttcaacacccccacggga
atcccaaagggcgtggtgagcttcaaaagtgggaactggggctgggccacagccggcagc
agcagcatcttggcggagtttggatccctgcacttggaattcttacacctcactgaactc
tctggcaaccaggtcttcgctgaaaaggtcaggaacatccgcaaggtcctcaggaagatc
gaaaagccctttggcctctaccccaacttcctcagcccagtgagtgggaactgggtgcaa
caccatgtctcagttggaggactcggggacagtttttatgaatatttgatcaaatcctgg
ttgatgtcgggcaagacagatatggaggctaaaaatatgtactacgaagccttggaggcg
atagagacctacttgctgaatgtctctcccggggggctgacctacattgccgagtggcga
ggggggattctggaccacaagatggggcacctggcctgtttctccgggggcatgatcgcc
cttggcgccgaggatgccaaggaagaaaagagggcccactaccgagagctcgcagcccag
atcaccaagacgtgtcacgagtcatacgcccgctcagacaccaaacttgggcctgaggcc
ttctggtttaactccggcagagaggccgtggccacccagctgagcgagagctactacatc
ctccggccagaggtggtggagagctacatgtacctgtggcgacagacccacaaccccatc
tacagggagtggggctgggaggtggtgctggccttggagaaatactgtcggacagaagcc
ggtttctctgggatccaagacgtgtacagtagcacccccaaccacgacaacaagcagcag
agcttctttctagcggagacactaaagatttga

DBGET integrated database retrieval system