KEGG   Homo sapiens (human): 57144Help
Entry
57144             CDS       T01001                                 

Gene name
PAK7, PAK5
Definition
p21 protein (Cdc42/Rac)-activated kinase 7 (EC:2.7.11.1)
Orthology
K05736  
p21-activated kinase 7 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p12
AA seq 719 aa AA seqDB search
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccgtccaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttaccggccttccccagcagtggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggacccttcatgcatcaca
cccatccagctggctcctatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctagaggattttgacaacatctcggtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgcg
gaagaaaatggcttcatcaccttctcccagtattccagcgaatccgatactactgctgac
tacacgaccgaaaagtacagggagaagagtctctatggagatgatctggatccgtattat
agaggcagccacgcagccaagcaaaatgggcacgtaatgaaaatgaagcacggggaggcc
tactattctgaggtgaagcctttgaaatccgattttgccagattttctgccgattatcac
tcacatttggactcactgagcaaaccaagtgaatacagtgacctcaagtgggagtatcag
agagcctcgagtagctcccctctggattattcattccaattcacaccttctagaactgca
gggaccagcgggtgctccaaggagagcctggcgtacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccaaagtcttcgtacctgaatcagacaagccctcagccc
accatgcggcagaggtccaggtcaggctcgggactccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacaactcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaatcgggctattcctcaagcagtcaccagtacccgtctgggtaccacaaagcc
accttgtaccatcacccctccctgcagagcagttcgcagtacatctccacggcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggctcctcctcc
gaccagcagccctccagggtgtcccatgaacagtttcgggcggccctgcagctggtggtc
agcccaggagaccccagggaatacttggccaactttatcaaaatcggggaaggctcaacc
ggcatcgtatgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgagaactgcttttcaatgaggtcgtgatcatgcgggat
taccaccatgacaatgtggttgacatgtacagcagctaccttgtcggcgatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtgactcacaccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagcgatggc
cggataaagttgtctgattttggtttctgtgctcaagtttccaaagaggtgccgaagagg
aaatcattggttggcactccctactggatggcccctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtccctcgggatcatggtgatagaaatgattgatggcgag
cccccctacttcaatgagcctcccctccaggcgatgcggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggattcctagacttgatg
ttggtgagggagccctctcagagagcaacagcccaggaactcctcggacatccattctta
aaactagcaggtccaccgtcttgcatcgtccccctcatgagacaatacaggcatcactga

DBGET integrated database retrieval system