KEGG   Homo sapiens (human): 57144Help
Entry
57144             CDS       T01001                                 

Gene name
PAK7, PAK5
Definition
p21 protein (Cdc42/Rac)-activated kinase 7 (EC:2.7.11.1)
Orthology
K05736  
p21-activated kinase 7 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    57144 (PAK7)
   04012 ErbB signaling pathway
    57144 (PAK7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    57144 (PAK7)
  Cell communication
   04510 Focal adhesion
    57144 (PAK7)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    57144 (PAK7)
  Development
   04360 Axon guidance
    57144 (PAK7)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    57144 (PAK7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     57144 (PAK7)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   57144 (PAK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p12
AA seq 719 aa AA seqDB search
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccgtccaactttgaacacagg
gttcatactgggtttgatccacaagagcagaagtttaccggccttccccagcagtggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggacccttcatgcatcaca
cccatccagctggctcctatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctagaggattttgacaacatctcggtgactcgctccaactcccta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgcg
gaagaaaatggcttcatcaccttctcccagtattccagcgaatccgatactactgctgac
tacacgaccgaaaagtacagggagaagagtctctatggagatgatctggatccgtattat
agaggcagccacgcagccaagcaaaatgggcacgtaatgaaaatgaagcacggggaggcc
tactattctgaggtgaagcctttgaaatccgattttgccagattttctgccgattatcac
tcacatttggactcactgagcaaaccaagtgaatacagtgacctcaagtgggagtatcag
agagcctcgagtagctcccctctggattattcattccaattcacaccttctagaactgca
gggaccagcgggtgctccaaggagagcctggcgtacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccaaagtcttcgtacctgaatcagacaagccctcagccc
accatgcggcagaggtccaggtcaggctcgggactccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacaactcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaatcgggctattcctcaagcagtcaccagtacccgtctgggtaccacaaagcc
accttgtaccatcacccctccctgcagagcagttcgcagtacatctccacggcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggctcctcctcc
gaccagcagccctccagggtgtcccatgaacagtttcgggcggccctgcagctggtggtc
agcccaggagaccccagggaatacttggccaactttatcaaaatcggggaaggctcaacc
ggcatcgtatgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgagaactgcttttcaatgaggtcgtgatcatgcgggat
taccaccatgacaatgtggttgacatgtacagcagctaccttgtcggcgatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtgactcacaccagaatg
aatgaagaacagatagctactgtctgcctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagcgatggc
cggataaagttgtctgattttggtttctgtgctcaagtttccaaagaggtgccgaagagg
aaatcattggttggcactccctactggatggcccctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtccctcgggatcatggtgatagaaatgattgatggcgag
cccccctacttcaatgagcctcccctccaggcgatgcggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggattcctagacttgatg
ttggtgagggagccctctcagagagcaacagcccaggaactcctcggacatccattctta
aaactagcaggtccaccgtcttgcatcgtccccctcatgagacaatacaggcatcactga

DBGET integrated database retrieval system