KEGG   Homo sapiens (human): 572Help
Entry
572               CDS       T01001                                 

Gene name
BAD, BBC2, BCL2L8
Definition
BCL2-associated agonist of cell death
Orthology
K02158  
BCL2-antagonist of cell death
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
Apoptosis
VEGF signaling pathway
Focal adhesion
Neurotrophin signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Pathways in cancer
Viral carcinogenesis
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    572 (BAD)
   04012 ErbB signaling pathway
    572 (BAD)
   04370 VEGF signaling pathway
    572 (BAD)
   04022 cGMP - PKG signaling pathway
    572 (BAD)
   04151 PI3K-Akt signaling pathway
    572 (BAD)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    572 (BAD)
  Cell communication
   04510 Focal adhesion
    572 (BAD)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    572 (BAD)
   04919 Thyroid hormone signaling pathway
    572 (BAD)
  Nervous system
   04722 Neurotrophin signaling pathway
    572 (BAD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    572 (BAD)
   05203 Viral carcinogenesis
    572 (BAD)
   05210 Colorectal cancer
    572 (BAD)
   05212 Pancreatic cancer
    572 (BAD)
   05221 Acute myeloid leukemia
    572 (BAD)
   05220 Chronic myeloid leukemia
    572 (BAD)
   05218 Melanoma
    572 (BAD)
   05215 Prostate cancer
    572 (BAD)
   05213 Endometrial cancer
    572 (BAD)
   05223 Non-small cell lung cancer
    572 (BAD)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    572 (BAD)
   05014 Amyotrophic lateral sclerosis (ALS)
    572 (BAD)
  Infectious diseases
   05152 Tuberculosis
    572 (BAD)
   05161 Hepatitis B
    572 (BAD)
   05160 Hepatitis C
    572 (BAD)
   05145 Toxoplasmosis
    572 (BAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.1
AA seq 168 aa AA seqDB search
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagccccgcaggggacgggccctcaggctccggcaagcatcatcgccag
gccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccat
catggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacg
gaggacgacgaagggatgggggaggagcccagcccctttcggggccgctcgcgctcggcg
ccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacgcag
atgcggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggc
aggggaagctccgccccctcccagtga

DBGET integrated database retrieval system