KEGG   Homo sapiens (human): 5721Help
Entry
5721              CDS       T01001                                 

Gene name
PSME2, PA28B, PA28beta, REGbeta
Definition
(RefSeq) proteasome activator subunit 2
  KO
K06697  
proteasome activator subunit 2 (PA28 beta)
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Antigen processing and presentation
Module
Immunoproteasome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    5721 (PSME2)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    5721 (PSME2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    5721 (PSME2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9UL46(Tbio)
UniProt: 
Position
14q12
AA seq 239 aa AA seqDB search
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSL
RAPLDIPIPDPPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCIL
VITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK
ETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccgtgtggggtgcgcctgagcggggaagcccgcaaacaggtggaggtcttc
agacagaatcttttccaggaggctgaggaattcctctacagattcttgccacagaaaatc
atatacctgaatcagctcttgcaagaggactccctcaatgtggctgacttgacttccctc
cgggccccactggacatccccatcccagaccctccacccaaggatgatgagatggaaaca
gataagcaggagaagaaagaagtccataagtgtggatttctccctgggaatgagaaagtc
ctgtccctgcttgccctggttaagccagaagtctggactctcaaagagaaatgcattctg
gtgattacatggatccaacacctgatccccaagattgaagatggaaatgattttggggta
gcaatccaggagaaggtgctggagagggtgaatgccgtcaagaccaaagtggaagctttc
cagacaaccatttccaagtacttctcagaacgtggggatgctgtggccaaggcctccaag
gagactcatgtaatggattaccgggccttggtgcatgagcgagatgaggcagcctatggg
gagctcagggccatggtgctggacctgagggccttctatgctgagctttatcatatcatc
agcagcaacctggagaaaattgtcaacccaaagggtgaagaaaagccatctatgtactga

DBGET integrated database retrieval system