KEGG   Homo sapiens (human): 573Help
Entry
573               CDS       T01001                                 

Gene name
BAG1, BAG-1, HAP, RAP46
Definition
BCL2-associated athanogene
Orthology
K09555  
BCL2-associated athanogene 1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p12
AA seq 230 aa AA seqDB search
MNRSQEVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQ
VVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKH
LEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTL
ILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggagccaggaggtgacccgggacgaggagtcgacccggagcgaggaggtgacc
agggaggaaatggcggcagctgggctcaccgtgactgtcacccacagcaatgagaagcac
gaccttcatgttacctcccagcagggcagcagtgaaccagttgtccaagacctggcccag
gttgttgaagaggtcataggggttccacagtcttttcagaaactcatatttaagggaaaa
tctctgaaggaaatggaaacaccgttgtcagcacttggaatacaagatggttgccgggtc
atgttaattgggaaaaagaacagtccacaggaagaggttgaactaaagaagttgaaacat
ttggagaagtctgtggagaagatagctgaccagctggaagagttgaataaagagcttact
ggaatccagcagggttttctgcccaaggatttgcaagctgaagctctctgcaaacttgat
aggagagtaaaagccacaatagagcagtttatgaagatcttggaggagattgacacactg
atcctgccagaaaatttcaaagacagtagattgaaaaggaaaggcttggtaaaaaaggtt
caggcattcctagccgagtgtgacacagtggagcagaacatctgccaggagactgagcgg
ctgcagtctacaaactttgccctggccgagtga

DBGET integrated database retrieval system