KEGG   Homo sapiens (human): 5734Help
Entry
5734              CDS       T01001                                 

Gene name
PTGER4, EP4, EP4R
Definition
(RefSeq) prostaglandin E receptor 4
  KO
K04261  
prostaglandin E receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Renin secretion
Pathways in cancer
Drug target
Grapiprant: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5734 (PTGER4)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    5734 (PTGER4)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5734 (PTGER4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5734 (PTGER4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    5734 (PTGER4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13.1
AA seq 488 aa AA seqDB search
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcccggggtcaattcgtccgcctccttgagccccgaccggctgaacagccca
gtgaccatcccggcggtgatgttcatcttcggggtggtgggcaacctggtggccatcgtg
gtgctgtgcaagtcgcgcaaggagcagaaggagacgaccttctacacgctggtatgtggg
ctggctgtcaccgacctgttgggcactttgttggtgagcccggtgaccatcgccacgtac
atgaagggccaatggcccgggggccagccgctgtgcgagtacagcaccttcattctgctc
ttcttcagcctgtccggcctcagcatcatctgcgccatgagtgtcgagcgctacctggcc
atcaaccatgcctatttctacagccactacgtggacaagcgattggcgggcctcacgctc
tttgcagtctatgcgtccaacgtgctcttttgcgcgctgcccaacatgggtctcggtagc
tcgcggctgcagtacccagacacctggtgcttcatcgactggaccaccaacgtgacggcg
cacgccgcctactcctacatgtacgcgggcttcagctccttcctcattctcgccaccgtc
ctctgcaacgtgcttgtgtgcggcgcgctgctccgcatgcaccgccagttcatgcgccgc
acctcgctgggcaccgagcagcaccacgcggccgcggccgcctcggttgcctcccggggc
caccccgctgcctccccagccttgccgcgcctcagcgactttcggcgccgccggagcttc
cgccgcatcgcgggcgccgagatccagatggtcatcttactcattgccacctccctggtg
gtgctcatctgctccatcccgctcgtggtgcgagtattcgtcaaccagttatatcagcca
agtttggagcgagaagtcagtaaaaatccagatttgcaggccatccgaattgcttctgtg
aaccccatcctagacccctggatatatatcctcctgagaaagacagtgctcagtaaagca
atagagaagatcaaatgcctcttctgccgcattggcgggtcccgcagggagcgctccgga
cagcactgctcagacagtcaaaggacatcttctgccatgtcaggccactctcgctccttc
atctcccgggagctgaaggagatcagcagtacatctcagaccctcctgccagacctctca
ctgccagacctcagtgaaaatggccttggaggcaggaatttgcttccaggtgtgcctggc
atgggcctggcccaggaagacaccacctcactgaggactttgcgaatatcagagacctca
gactcttcacagggtcaggactcagagagtgtcttactggtggatgaggctggtgggagc
ggcagggctgggcctgcccctaaggggagctccctgcaagtcacatttcccagtgaaaca
ctgaacttatcagaaaaatgtatataa

DBGET integrated database retrieval system