KEGG   Homo sapiens (human): 5737Help
Entry
5737              CDS       T01001                                 

Gene name
PTGFR, FP
Definition
(RefSeq) prostaglandin F receptor
  KO
K04262  prostaglandin F receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Bimatoprost: D02724
Carboprost (DG00449): D00682 D02343 D03399
Dinoprost (DG00447): D00081 D01352
Latanoprost: D00356
Latanoprostene bunod: D10441
Rosaprostol: D02719
Tafluprost: D06274
Tiaprost: D08591
Travoprost: D01964
Unoprostone (DG01139): D01452 D08661
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5737 (PTGFR)
   04072 Phospholipase D signaling pathway
    5737 (PTGFR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5737 (PTGFR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    5737 (PTGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv Serpentine_r_xa C_GCAxxG_C_C
Motif
Other DBs
NCBI-GeneID: 5737
NCBI-ProteinID: NP_000950
OMIM: 600563
HGNC: 9600
Ensembl: ENSG00000122420
Vega: OTTHUMG00000009644
Pharos: P43088(Tclin)
UniProt: P43088
Position
1p31.1
AA seq 359 aa AA seqDB search
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL
CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ
ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG
RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaacaattccaaacagctagtgtctcctgcagctgcgcttctttcaaacaca
acctgccagacggaaaaccggctttccgtatttttttcagtaatcttcatgacagtggga
atcttgtcaaacagccttgccatcgccattctcatgaaggcatatcagagatttagacag
aagtccaaggcatcgtttctgcttttggccagtggcctggtaatcactgatttctttggc
catctcatcaatggagccatagcagtatttgtatatgcttctgataaagaatggatccgc
tttgaccaatcaaatgtcctttgcagtatttttggtatctgcatggtgttttctggtctg
tgcccacttcttctaggcagtgtgatggccattgagcggtgtattggagtcacaaaacca
atatttcattctacgaaaattacatccaaacatgtgaaaatgatgttaagtggtgtgtgc
ttgtttgctgttttcatagctttgctgcccatccttggacatcgagactataaaattcag
gcgtcgaggacctggtgtttctacaacacagaagacatcaaagactgggaagatagattt
tatcttctacttttttcttttctggggctcttagcccttggtgtttcattgttgtgcaat
gcaatcacaggaattacacttttaagagttaaatttaaaagtcagcagcacagacaaggc
agatctcatcatttggaaatggtaatccagctcctggcgataatgtgtgtctcctgtatt
tgttggagcccatttctggttacaatggccaacattggaataaatggaaatcattctctg
gaaacctgtgaaacaacactttttgctctccgaatggcaacatggaatcaaatcttagat
ccttgggtatatattcttctacgaaaggctgtccttaagaatctctataagcttgccagt
caatgctgtggagtgcatgtcatcagcttacatatttgggagcttagttccattaaaaat
tccttaaaggttgctgctatttctgagtcaccagttgcagagaaatcagcaagcacctag

DBGET integrated database retrieval system