KEGG   Homo sapiens (human): 5737Help
Entry
5737              CDS       T01001                                 

Gene name
PTGFR, FP
Definition
prostaglandin F receptor (FP)
Orthology
K04262  
prostaglandin F receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Dinoprost: 
Carboprost: 
Latanoprost: 
Unoprostone: 
Bimatoprost: 
Travoprost: 
Tafluprost: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5737 (PTGFR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5737 (PTGFR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    5737 (PTGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.1
AA seq 359 aa AA seqDB search
MSMNNSKQLVSPAAALLSNTTCQTENRLSVFFSVIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGL
CPLLLGSVMAIERCIGVTKPIFHSTKITSKHVKMMLSGVCLFAVFIALLPILGHRDYKIQ
ASRTWCFYNTEDIKDWEDRFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQG
RSHHLEMVIQLLAIMCVSCICWSPFLVTMANIGINGNHSLETCETTLFALRMATWNQILD
PWVYILLRKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAISESPVAEKSAST
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaacaattccaaacagctagtgtctcctgcagctgcgcttctttcaaacaca
acctgccagacggaaaaccggctttccgtatttttttcagtaatcttcatgacagtggga
atcttgtcaaacagccttgccatcgccattctcatgaaggcatatcagagatttagacag
aagtccaaggcatcgtttctgcttttggccagtggcctggtaatcactgatttctttggc
catctcatcaatggagccatagcagtatttgtatatgcttctgataaagaatggatccgc
tttgaccaatcaaatgtcctttgcagtatttttggtatctgcatggtgttttctggtctg
tgcccacttcttctaggcagtgtgatggccattgagcggtgtattggagtcacaaaacca
atatttcattctacgaaaattacatccaaacatgtgaaaatgatgttaagtggtgtgtgc
ttgtttgctgttttcatagctttgctgcccatccttggacatcgagactataaaattcag
gcgtcgaggacctggtgtttctacaacacagaagacatcaaagactgggaagatagattt
tatcttctacttttttcttttctggggctcttagcccttggtgtttcattgttgtgcaat
gcaatcacaggaattacacttttaagagttaaatttaaaagtcagcagcacagacaaggc
agatctcatcatttggaaatggtaatccagctcctggcgataatgtgtgtctcctgtatt
tgttggagcccatttctggttacaatggccaacattggaataaatggaaatcattctctg
gaaacctgtgaaacaacactttttgctctccgaatggcaacatggaatcaaatcttagat
ccttgggtatatattcttctacgaaaggctgtccttaagaatctctataagcttgccagt
caatgctgtggagtgcatgtcatcagcttacatatttgggagcttagttccattaaaaat
tccttaaaggttgctgctatttctgagtcaccagttgcagagaaatcagcaagcacctag

DBGET integrated database retrieval system