KEGG   Homo sapiens (human): 5742Help
Entry
5742              CDS       T01001                                 

Gene name
PTGS1, COX1, COX3, PCOX1, PES-1, PGG/HS, PGHS-1, PGHS1, PHS1, PTGHS
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) (EC:1.14.99.1)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Drug target
Benzydamine: 
Acetylsalicylic acid: 
Indobufen: 
Aloxiprin: 
Triflusal: 
Indometacin: 
Ibuprofen: 
Diclofenac: 
Naproxen: 
Phenylbutazone: 
Oxyphenbutazone: 
Indometacin: 
Sulindac: 
Tolmetin: 
Acemetacin: 
Proglumetacin: 
Ketorolac: 
Piroxicam: 
Tenoxicam: 
Lornoxicam: 
Ibuprofen: 
Ketoprofen: 
Fenoprofen: 
Flurbiprofen: 
Tiaprofenic acid: 
Oxaprozin: 
Dexibuprofen: 
Alminoprofen: 
Dexketoprofen: 
Mefenamic acid: 
Tolfenamic acid: 
Flufenamic acid: 
Meclofenamic acid: 
Etofenamate: 
Felbinac: 
Acetylsalicylic acid: 
Choline salicylate: 
Sodium salicylate: 
Salicylamide: 
Salsalate: 
Diflunisal: 
Flurbiprofen: 
Pranoprofen: 
Nepafenac: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    5742 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5742 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    5742 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    5742 (PTGS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     5742 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q32-q33.3
AA seq 599 aa AA seqDB search
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctctggttcttgctgttcctgctcctgctcccgccgctcccc
gtcctgctcgcggacccaggggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgc
acgggctattccggccccaactgcaccatccctggcctgtggacctggctccggaattca
ctgcggcccagcccctctttcacccacttcctgctcactcacgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagattgccccaca
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggccacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggatggagaaatg
tacccgccctcggtagaagaggcgcctgtgttgatgcactacccccgaggcatcccgccc
cagagccagatggctgtgggccaggaggtgtttgggctgcttcctgggctcatgctgtat
gccacgctctggctacgtgagcacaaccgtgtgtgtgacctgctgaaggctgagcacccc
acctggggcgatgagcagcttttccagacgacccgcctcatcctcataggggagaccatc
aagattgtcatcgaggagtacgtgcagcagctgagtggctatttcctgcagctgaaattt
gacccagagctgctgttcggtgtccagttccaataccgcaaccgcattgccatggagttc
aaccatctctaccactggcaccccctcatgcctgactccttcaaggtgggctcccaggag
tacagctacgagcagttcttgttcaacacctccatgttggtggactatggggttgaggcc
ctggtggatgccttctctcgccagattgctggccggatcggtgggggcaggaacatggac
caccacatcctgcatgtggctgtggatgtcatcagggagtctcgggagatgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaaaccctacacctccttccaggagctc
gtaggagagaaggagatggcagcagagttggaggaattgtatggagacattgatgcgttg
gagttctaccctggactgcttcttgaaaagtgccatccaaactctatctttggggagagt
atgatagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttct
ccggagtactggaagccgagcacatttggcggcgaggtgggctttaacattgtcaagacg
gccacactgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgt
gtgccggatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system