KEGG   Homo sapiens (human): 5742Help
Entry
5742              CDS       T01001                                 

Gene name
PTGS1, COX1, COX3, PCOX1, PES-1, PGG/HS, PGHS-1, PGHS1, PHS1, PTGHS
Definition
prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) (EC:1.14.99.1)
Orthology
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Drug target
Benzydamine: 
Acetylsalicylic acid: 
Indobufen: 
Aloxiprin: 
Triflusal: 
Indometacin: 
Ibuprofen: 
Diclofenac: 
Naproxen: 
Phenylbutazone: 
Oxyphenbutazone: 
Indometacin: 
Sulindac: 
Tolmetin: 
Acemetacin: 
Proglumetacin: 
Ketorolac: 
Piroxicam: 
Tenoxicam: 
Lornoxicam: 
Ibuprofen: 
Ketoprofen: 
Fenoprofen: 
Flurbiprofen: 
Tiaprofenic acid: 
Oxaprozin: 
Dexibuprofen: 
Alminoprofen: 
Dexketoprofen: 
Mefenamic acid: 
Tolfenamic acid: 
Flufenamic acid: 
Meclofenamic acid: 
Etofenamate: 
Felbinac: 
Acetylsalicylic acid: 
Choline salicylate: 
Sodium salicylate: 
Salicylamide: 
Salsalate: 
Diflunisal: 
Flurbiprofen: 
Pranoprofen: 
Nepafenac: 
Other: 
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q32-q33.3
AA seq 599 aa AA seqDB search
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctctggttcttgctgttcctgctcctgctcccgccgctcccc
gtcctgctcgcggacccaggggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgc
acgggctattccggccccaactgcaccatccctggcctgtggacctggctccggaattca
ctgcggcccagcccctctttcacccacttcctgctcactcacgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagattgccccaca
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ctgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggccacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggatggagaaatg
tacccgccctcggtagaagaggcgcctgtgttgatgcactacccccgaggcatcccgccc
cagagccagatggctgtgggccaggaggtgtttgggctgcttcctgggctcatgctgtat
gccacgctctggctacgtgagcacaaccgtgtgtgtgacctgctgaaggctgagcacccc
acctggggcgatgagcagcttttccagacgacccgcctcatcctcataggggagaccatc
aagattgtcatcgaggagtacgtgcagcagctgagtggctatttcctgcagctgaaattt
gacccagagctgctgttcggtgtccagttccaataccgcaaccgcattgccatggagttc
aaccatctctaccactggcaccccctcatgcctgactccttcaaggtgggctcccaggag
tacagctacgagcagttcttgttcaacacctccatgttggtggactatggggttgaggcc
ctggtggatgccttctctcgccagattgctggccggatcggtgggggcaggaacatggac
caccacatcctgcatgtggctgtggatgtcatcagggagtctcgggagatgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaaaccctacacctccttccaggagctc
gtaggagagaaggagatggcagcagagttggaggaattgtatggagacattgatgcgttg
gagttctaccctggactgcttcttgaaaagtgccatccaaactctatctttggggagagt
atgatagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttct
ccggagtactggaagccgagcacatttggcggcgaggtgggctttaacattgtcaagacg
gccacactgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgt
gtgccggatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system