KEGG   Homo sapiens (human): 5743Help
Entry
5743              CDS       T01001                                 

Gene name
PTGS2, COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2
Definition
prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (EC:1.14.99.1)
Orthology
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Leishmaniasis
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Disease
H00017  
Esophageal cancer
H00025  
Penile cancer
H00046  
Cholangiocarcinoma
Drug target
Benzydamine: 
Acetylsalicylic acid: 
Indobufen: 
Aloxiprin: 
Indometacin: 
Ibuprofen: 
Diclofenac: 
Naproxen: 
Celecoxib: 
Phenylbutazone: 
Oxyphenbutazone: 
Indometacin: 
Sulindac: 
Tolmetin: 
Etodolac: 
Acemetacin: 
Proglumetacin: 
Ketorolac: 
Aceclofenac: 
Piroxicam: 
Tenoxicam: 
Lornoxicam: 
Meloxicam: 
Ibuprofen: 
Ketoprofen: 
Fenoprofen: 
Flurbiprofen: 
Tiaprofenic acid: 
Oxaprozin: 
Dexibuprofen: 
Alminoprofen: 
Dexketoprofen: 
Mefenamic acid: 
Tolfenamic acid: 
Flufenamic acid: 
Meclofenamic acid: 
Rofecoxib: 
Valdecoxib: 
Parecoxib: 
Etoricoxib: 
Lumiracoxib: 
Nabumetone: 
Niflumic acid: 
Nimesulide: 
Etofenamate: 
Felbinac: 
Acetylsalicylic acid: 
Choline salicylate: 
Sodium salicylate: 
Salicylamide: 
Salsalate: 
Diflunisal: 
Floctafenine: 
Flurbiprofen: 
Pranoprofen: 
Nepafenac: 
Bromfenac: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    5743 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    5743 (PTGS2)
   04064 NF-kappa B signaling pathway
    5743 (PTGS2)
   04668 TNF signaling pathway
    5743 (PTGS2)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    5743 (PTGS2)
   04921 Oxytocin signaling pathway
    5743 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    5743 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    5743 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5743 (PTGS2)
   05206 MicroRNAs in cancer
    5743 (PTGS2)
   05204 Chemical carcinogenesis
    5743 (PTGS2)
   05222 Small cell lung cancer
    5743 (PTGS2)
  Infectious diseases
   05140 Leishmaniasis
    5743 (PTGS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     5743 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.2-q25.3
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatacagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttttg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcct
gtgcctgatgattgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaattgcttctaagaagaaagttcatccctgatccccagggctca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaacgggctgggccatggggtggacttaaatcatatttac
ggtgaaactctggctagacagcgtaaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgaatttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatattg
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacagaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcggcca
gatgccatctttggtgaaaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcattaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system