KEGG   Homo sapiens (human): 5743Help
Entry
5743              CDS       T01001                                 

Gene name
PTGS2, COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2
Definition
prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (EC:1.14.99.1)
Orthology
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
NF-kappa B signaling pathway
VEGF signaling pathway
TNF signaling pathway
Retrograde endocannabinoid signaling
Serotonergic synapse
Ovarian steroidogenesis
Oxytocin signaling pathway
Leishmaniasis
Pathways in cancer
Chemical carcinogenesis
MicroRNAs in cancer
Small cell lung cancer
Disease
H00017  
Esophageal cancer
H00025  
Penile cancer
H00046  
Cholangiocarcinoma
Drug target
Benzydamine: 
Acetylsalicylic acid: 
Indobufen: 
Aloxiprin: 
Indometacin: 
Ibuprofen: 
Diclofenac: 
Naproxen: 
Celecoxib: 
Phenylbutazone: 
Oxyphenbutazone: 
Indometacin: 
Sulindac: 
Tolmetin: 
Etodolac: 
Acemetacin: 
Proglumetacin: 
Ketorolac: 
Aceclofenac: 
Piroxicam: 
Tenoxicam: 
Lornoxicam: 
Meloxicam: 
Ibuprofen: 
Ketoprofen: 
Fenoprofen: 
Flurbiprofen: 
Tiaprofenic acid: 
Oxaprozin: 
Dexibuprofen: 
Alminoprofen: 
Dexketoprofen: 
Mefenamic acid: 
Tolfenamic acid: 
Flufenamic acid: 
Meclofenamic acid: 
Rofecoxib: 
Valdecoxib: 
Parecoxib: 
Etoricoxib: 
Lumiracoxib: 
Nabumetone: 
Niflumic acid: 
Nimesulide: 
Etofenamate: 
Felbinac: 
Acetylsalicylic acid: 
Choline salicylate: 
Sodium salicylate: 
Salicylamide: 
Salsalate: 
Diflunisal: 
Floctafenine: 
Flurbiprofen: 
Pranoprofen: 
Nepafenac: 
Bromfenac: 
Other: 
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:hsa05204]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q25.2-q25.3
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatacagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttttg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcct
gtgcctgatgattgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaattgcttctaagaagaaagttcatccctgatccccagggctca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaacgggctgggccatggggtggacttaaatcatatttac
ggtgaaactctggctagacagcgtaaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgaatttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatattg
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacagaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcggcca
gatgccatctttggtgaaaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcattaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system