KEGG   Homo sapiens (human): 5747Help
Entry
5747              CDS       T01001                                 

Gene name
PTK2, FADK, FAK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
Definition
protein tyrosine kinase 2 (EC:2.7.10.2)
Orthology
K05725  
focal adhesion kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Amoebiasis
Pathways in cancer
Transcriptional misregulation in cancer
Proteoglycans in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    5747 (PTK2)
   04370 VEGF signaling pathway
    5747 (PTK2)
   04151 PI3K-Akt signaling pathway
    5747 (PTK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5747 (PTK2)
  Cellular commiunity
   04510 Focal adhesion
    5747 (PTK2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    5747 (PTK2)
   04062 Chemokine signaling pathway
    5747 (PTK2)
  Development
   04360 Axon guidance
    5747 (PTK2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5747 (PTK2)
   05202 Transcriptional misregulation in cancers
    5747 (PTK2)
   05205 Proteoglycans in cancer
    5747 (PTK2)
   05222 Small cell lung cancer
    5747 (PTK2)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    5747 (PTK2)
   05146 Amoebiasis
    5747 (PTK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     5747 (PTK2)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  FAK family
   5747 (PTK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5747 (PTK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 1065 aa AA seqDB search
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPGKEEKNWAERNPAAPPKKPPRPGAPGHLGSLAS
LSSPADSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPP
EEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQY
VMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcttaccttgaccccaacttgaatcacacaccaaattcgagtactaagact
cacctgggtactggtatggaacgttctcctggtgcaatggagcgagtattaaaggtcttt
cattattttgaaagcaatagtgagccaaccacctgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcatgtg
gcctgctatggattccgcctcagtcacctgcggtcagaggaggttcactggcttcacgtg
gatatgggcgtctccagtgtgagggagaagtatgagcttgctcacccaccagaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagat
aagccaactttgaatttcttctatcaacaggtgaagagcgattatatgttagagatagct
gatcaagtggaccaggaaattgctttgaagttgggttgtctagaaatacggcgatcatac
tgggagatgcggggcaatgcactagaaaagaagtctaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaaactgatccaacaaacatttagacaatttgccaaccttaatagagaagaaagtatt
ctgaaattctttgagatcctgtctccagtctacagatttgataaggaatgcttcaagtgt
gctcttggttcaagctggattatttcagtggaactggcaatcggcccagaagaaggaatc
agttacctaacggacaagggctgcaatcccacacatcttgctgacttcactcaagtgcaa
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacaactaaaaata
gcaggtgcacccgagcctctgacagtgacggcaccatccctaaccattgcggagaatatg
gctgacctaatagatgggtactgccggctggtgaatggaacctcgcagtcatttatcatc
agacctcagaaagaaggtgaacgggctttgccatcaataccaaagttggccaacagcgaa
aagcaaggcatgcggacacacgccgtctctgtgtcagaaacagatgattatgctgagatt
atagatgaagaagatacttacaccatgccctcaaccagggattatgagattcaaagagaa
agaatagaacttggacgatgtattggagaaggccaatttggagatgtacatcaaggcatt
tatatgagtccagagaatccagctttggcggttgcaattaaaacatgtaaaaactgtact
tcggacagcgtgagagagaaatttcttcaagaagccttaacaatgcgtcagtttgaccat
cctcatattgtgaagctgattggagtcatcacagagaatcctgtctggataatcatggag
ctgtgcacacttggagagctgaggtcatttttgcaagtaaggaaatacagtttggatcta
gcatctttgatcctgtatgcctatcagcttagtacagctcttgcatatctagagagcaaa
agatttgtacacagggacattgctgctcggaatgttctggtgtcctcaaatgattgtgta
aaattaggagactttggattatcccgatatatggaagatagtacttactacaaagcttcc
aaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtatggatgtttggtgtgtgtatgtgggagatactgatgcatggtgtg
aagccttttcaaggagtgaagaacaatgatgtaatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgggcc
tatgaccccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatcctg
gaggaagagaaggctcagcaagaagagcgcatgaggatggagtccagaagacaggccaca
gtgtcctgggactccggagggtctgatgaagcaccgcccaagcccagcagaccgggttat
cccagtccgaggtccagcgaaggattttatcccagcccacagcacatggtacaaaccaat
cattaccaggtttctggctaccctggttcacatggaatcacagccatggctggcagcatc
tatccaggtcaggcatctcttttggaccaaacagattcatggaatcatagacctcaggag
atagcaatgtggcagcccaatgtggaggactctacagtattggacctgcgagggattggg
caagtgttgccaacccatctgatggaagagcgtctaatccgacagcaacaggaaatggaa
gaagatcagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactctct
cgaggcagtattgacagggaggatggaagtcttcagggtccgattggaaaccaacatata
tatcagcctgtgggtaaaccaggtaaagaagaaaagaattgggcggaaagaaatcctgca
gctccaccaaagaaaccgcctcgccctggagctcccggtcatctgggaagccttgccagc
ctcagcagccctgctgacagctacaacgagggtgtcaagccatggaggcttcagccccag
gaaatcagcccccctcctactgccaacctggaccggtcgaatgataaggtgtacgagaat
gtgacgggcctggtgaaagctgtcatcgagatgtccagtaaaatccagccagccccacca
gaggagtatgtccctatggtgaaggaagtcggcttggccctgaggacattattggccact
gtggatgagaccattcccctcctaccagccagcacccaccgagagattgagatggcacag
aagctattgaactctgacctgggtgagctcatcaacaagatgaaactggcccagcagtat
gtcatgaccagcctccagcaagagtacaaaaagcaaatgctgactgctgctcacgccctg
gctgtggatgccaaaaacttactcgatgtcattgaccaagcaagactgaaaatgcttggg
cagacgagaccacactga

DBGET integrated database retrieval system