KEGG   Homo sapiens (human): 57502Help
Entry
57502             CDS       T01001                                 

Gene name
NLGN4X, ASPGX2, AUTSX2, HLNX, HNL4X, NLGN4
Definition
neuroligin 4, X-linked
Orthology
K07378  
neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Disease
H00480  
Non-syndromic X-linked mental retardation
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.33
AA seq 816 aa AA seqDB search
MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNTNYGKIRGLRT
PLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLL
HDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEG
TGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGA
FGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
ADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQG
EFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEM
KPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPV
PQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPED
TTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTND
IAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTIT
MIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggccccagggactgctatggcttcctttgttgttcaccccggtctgcgtcatg
ttaaactccaatgtcctcctgtggttaactgctcttgccatcaagttcaccctcattgac
agccaagcacagtatccagttgtcaacacaaattatggcaaaatccggggcctaagaaca
ccgttacccaatgagatcttgggtccagtggagcagtacttaggggtcccctatgcctca
ccccccactggagagaggcggtttcagcccccagaacccccgtcctcctggactggcatc
cgaaatactactcagtttgctgctgtgtgcccccagcacctggatgagagatccttactg
catgacatgctgcccatctggtttaccgccaatttggatactttgatgacctatgttcaa
gatcaaaatgaagactgcctttacttaaacatctacgtgcccacggaagatgatattcat
gatcagaacagtaagaagcccgtcatggtctatatccatgggggatcttacatggagggc
accggcaacatgattgacggcagcattttggcaagctacggaaacgtcatcgtgatcacc
attaactaccgtctgggaatactagggtttttaagtaccggtgaccaggcagcaaaaggc
aactatgggctcctggatcagattcaagcactgcggtggattgaggagaatgtgggagcc
tttggcggggaccccaagagagtgaccatctttggctcgggggctggggcctcctgtgtc
agcctgttgaccctgtcccactactcagaaggtctcttccagaaggccatcattcagagc
ggcaccgccctgtccagctgggcagtgaactaccagccggccaagtacactcggatattg
gcagacaaggtcggctgcaacatgctggacaccacggacatggtagaatgcctgcggaac
aagaactacaaggagctcatccagcagaccatcaccccggccacctaccacatagccttc
gggccggtgatcgacggcgacgtcatcccagacgacccccagatcctgatggagcaaggc
gagttcctcaactacgacatcatgctgggcgtcaaccaaggggaaggcctgaagttcgtg
gacggcatcgtggataacgaggacggtgtgacgcccaacgactttgacttctccgtgtcc
aacttcgtggacaacctttacggctaccctgaagggaaagacactttgcgggagactatc
aagttcatgtacacagactgggccgataaggaaaacccggagacgcggcggaaaaccctg
gtggctctctttactgaccaccagtgggtggcccccgccgtggccaccgccgacctgcac
gcgcagtacggctcccccacctacttctatgccttctatcatcactgccaaagcgaaatg
aagcccagctgggcagattcggcccatggtgatgaggtcccctatgtcttcggcatcccc
atgatcggtcccaccgagctcttcagttgtaacttttccaagaacgacgtcatgctcagc
gccgtggtcatgacctactggacgaacttcgccaaaactggtgatccaaatcaaccagtt
cctcaggataccaagttcattcacacaaaacccaaccgctttgaagaagtggcctggtcc
aagtataatcccaaagaccagctctatctgcatattggcttgaaacccagagtgagagat
cactaccgggcaacgaaagtggctttctggttggaactcgttcctcatttgcacaacttg
aacgagatattccagtatgtttcaacaaccacaaaggttcctccaccagacatgacatca
tttccctatggcacccggcgatctcccgccaagatatggccaaccaccaaacgcccagca
atcactcctgccaacaatcccaaacactctaaggaccctcacaaaacagggcctgaggac
acaactgtcctcattgaaaccaaacgagattattccaccgaattaagtgtcaccattgcc
gtcggggcgtcgctcctcttcctcaacatcttagcttttgcggcgctgtactacaaaaag
gacaagaggcgccatgagactcacaggcgccccagtccccagagaaacaccacaaatgat
atcgctcacatccagaacgaagagatcatgtctctgcagatgaagcagctggaacacgat
cacgagtgtgagtcgctgcaggcacacgacacactgaggctcacctgcccgccagactac
accctcacgctgcgccggtcgccagatgacatcccacttatgacgccaaacaccatcacc
atgattccaaacacactgacggggatgcagcctttgcacacttttaacaccttcagtgga
ggacaaaacagtacaaatttaccccacggacattccaccactagagtatag

DBGET integrated database retrieval system