KEGG   Homo sapiens (human): 57551Help
Entry
57551             CDS       T01001                                 

Gene name
TAOK1, KFC-B, MAP3K16, MARKK, PSK-2, PSK2, TAO1, hKFC-B, hTAOK1
Definition
TAO kinase 1 (EC:2.7.11.1)
Orthology
K04429  
thousand and one amino acid protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    57551 (TAOK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     57551 (TAOK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   57551 (TAOK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 1001 aa AA seqDB search
MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMS
YSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLIQRTKDA
VRELDNLQYRKMKKLLFQEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGSNQSIPSMSIS
ASSQSSSVNSLPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQ
SPPQVSRHKSHYRNREHFATIRTASLVTRQMQEHEQDSELREQMSGYKRMRRQHQKQLMT
LENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHI
QAQQKKELNSFLESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEE
ANLLRRQRQYLELECRRFKRRMLLGRHNLEQDLVREELNKRQTQKDLEHAMLLRQHESMQ
ELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKEL
QIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQTRKLAILAEQYDHSIN
EMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSL
RRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAF
SHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSM
GVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaactaacagagcaggcagcctgaaggaccctgaaattgcagagctcttcttc
aaagaagatccagagaagctcttcacagatctcagagaaattggccatggaagctttgga
gcagtgtattttgcacgagatgtgcgtaccaatgaagtggtggccatcaagaaaatgtct
tatagtggaaagcagtctactgagaaatggcaggatattattaaggaagtcaagtttcta
caaagaataaaacatcccaacagtatagaatacaaaggctgttatttacgtgaacacaca
gcatggcttgtaatggaatattgtttaggatctgcttcggatttactagaagttcacaaa
aagccattacaagaagtggaaatagcagcaattacacatggtgctcttcagggattagcc
tacttacattctcatactatgattcatagagatatcaaagcaggaaatatccttctgaca
gaaccaggccaggtgaaacttgctgactttggctctgcttccatggcatcacctgccaat
tcctttgtgggaacgccgtattggatggccccagaagtaattttagccatggatgaagga
caatatgatggcaaagtagatgtgtggtctcttggaataacatgtattgaactagcggaa
aggaagcctcctttatttaatatgaatgcaatgagtgccttatatcacatagcccaaaat
gaatcccctacactacagtctaatgaatggtctgattattttcgcaactttgtagattct
tgcctccagaaaatccctcaagatcgacctacatcagaggaacttttaaagcacatattt
gttcttcgggagcgccctgaaaccgtgttaatagatctcattcagaggacaaaggatgca
gtaagagagctggacaatctgcagtatcgaaagatgaagaaactccttttccaggaggca
cataatggaccagcagtagaagcacaggaagaagaagaggaacaagatcatggtgttggc
cggacaggaacagttaatagtgttggaagtaatcaatccattcccagcatgtccatcagt
gccagcagccaaagcagtagtgttaacagtcttccagatgtctcagatgacaagagtgag
ctagacatgatggagggagaccacacagtgatgtctaacagttctgttatccatttaaaa
ccagaggaagaaaattacagagaagagggagatcctagaacaagagcatcagatccacaa
tctccaccccaagtatctcgtcacaaatcacactatcgtaatcgagaacactttgctact
atacggacagcatcactggttacgaggcaaatgcaagaacatgagcaggactctgagctt
agagaacaaatgtctggctataagcgaatgaggcgacaacatcaaaagcaactgatgact
ctggaaaacaagctaaaggctgagatggatgaacatcgcctcagattagacaaagatctt
gaaactcagcgtaacaattttgctgcagaaatggagaaacttatcaagaaacaccaggct
gccatggagaaagaggctaaagtgatgtccaatgaagagaaaaaatttcagcaacatatt
caggcccaacagaagaaagaactgaatagttttctcgagtcccagaaaagagagtataaa
cttcgaaaagagcagcttaaagaggagctaaatgaaaaccagagtacccccaaaaaagaa
aaacaggagtggctttcaaagcagaaggagaatatacagcatttccaagcagaagaagaa
gctaaccttcttcgacgtcaaagacaatacctagagctggaatgccgtcgcttcaagaga
agaatgttacttgggcgtcataacttagagcaggaccttgtcagggaggagttaaacaaa
agacagactcagaaggacttagagcatgccatgctactccgacagcatgaatctatgcaa
gaactggagttccgccacctcaacacaattcagaagatgcgctgtgagttgatcagatta
cagcatcaaactgagctcactaaccagctggaatataataagcgaagagaacgagaacta
agacgaaagcatgtcatggaagttcgacaacagcctaagagtttgaagtctaaagaactc
caaataaaaaagcagtttcaggatacctgcaaaatccaaaccagacagtacaaagcatta
agaaatcacctgctggagactacaccaaagagtgagcacaaagctgttctgaaacggctc
aaggaggaacagacccggaaattagctatcttggctgagcagtatgatcacagcattaat
gaaatgctctccacacaagccctgcgtttggatgaagcacaggaagcagagtgccaggtt
ttgaagatgcagctgcagcaggaactggagctgttgaatgcgtatcagagcaaaatcaag
atgcaagctgaggcacaacatgatcgagagcttcgcgagcttgaacagagggtctccctc
cggagggcactcttagaacaaaagattgaagaagagatgttggctttgcagaatgagcgc
acagaacgaatacgaagcctgttggaacgtcaagccagagagattgaagcttttgactct
gaaagcatgagactaggttttagtaatatggtcctttctaatctctcccctgaggcattc
agccacagctacccgggagcttctggttggtcacacaaccctactgggggtccaggacct
cactggggtcatcccatgggtggcccaccacaagcttggggccatccaatgcaaggtgga
ccccagccatggggtcacccttcagggccaatgcaaggggtacctcgaggtagcagtatg
ggagtccgcaatagcccccaggctctgaggcggacagcttctgggggacggacggagcag
ggcatgagcagaagcacgagtgtcacttcacaaatatccaatgggtcacacatgtcttat
acataa

DBGET integrated database retrieval system